(data stored in ACNUC1104 zone)

EMBL: AM420293.PE361

AM420293.PE361       Location/Qualifiers
FT   CDS_pept        406092..406895
FT                   /transl_table=11
FT                   /locus_tag="SACE_0368"
FT                   /product="type II secretion system protein"
FT                   /function="Flp pilus assembly protein TadB"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99716"
FT                   /db_xref="GOA:A4F6P2"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6P2"
FT                   /protein_id="CAL99716.1"
FT                   /translation="MLTFLLLALSLLCWPDLRAQRRLGALTSTTSWSSGAMVVRVARIG
FT                   WIPVAAALGALLAGVGGLFAAVALAVLGRRYVRSRRSFRVGVERSAELSGGIRLLVAGL
FT                   RAGAHPAVAAEGAAADSAPAISGVFRDLASAAKLGGDIPTVLDNGGHPAELRQPLARLG
FT                   RAWRLAERHGVALADLLDAVRRDVDHRVAFIRDLESKMAGPRATAAMLAGLPLLGLLLG
FT                   EAVGAAPLAVLTGQAFGQAVLVVGVALLCAGLFWTLRLTEGAISP"
     gtgctgacgt tcctcctgct cgcgctgtcg ttgctctgct ggcccgatct gcgggcgcag        60
     cgaaggcttg gcgcgttgac ctcgaccacc tcgtggtcat cgggagcaat ggtggtccga       120
     gtggcacgga tcggctggat accggtcgcc gccgcgctcg gagccctcct cgcaggtgtc       180
     ggcggcctgt tcgcggccgt ggcgctggcc gttctcggac gtcgatacgt gcggtcccgg       240
     cggagcttcc gcgtcggggt ggagcggtct gccgaactct ccggtggcat ccggttgctg       300
     gtggccgggc tccgcgccgg cgcacatccg gctgtggcgg cggagggcgc ggcagcggac       360
     tcggcacctg cgatatccgg ggtcttccgg gacctggcgt ccgcggcgaa gctcggcggt       420
     gacatcccga cggtgctcga caacggcggc caccccgccg agctccggca accgctggcg       480
     cggctcggcc gggcgtggag gctcgccgag cggcacggcg tggcgctggc ggacctgctg       540
     gacgcggtgc ggcgcgacgt cgaccaccgg gtcgccttca tccgcgatct cgagtcgaag       600
     atggcgggcc cgcgtgccac cgcggccatg ctcgccggcc tgcccctgct cggcctgctc       660
     ctgggcgaag cggtcggtgc ggcaccgctg gccgtactta ccgggcaggc attcggccag       720
     gccgtcctgg tcgtgggcgt cgccctgttg tgcgccggcc tgttctggac cctccgcctg       780
     acggagggag cgatatctcc atga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page