(data stored in ACNUC1104 zone)

EMBL: AM420293.PE362

AM420293.PE362       Location/Qualifiers
FT   CDS_pept        407768..408199
FT                   /transl_table=11
FT                   /locus_tag="SACE_0369"
FT                   /product="type II secretion system protein"
FT                   /function="Flp pilus assembly protein TadC"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99717"
FT                   /db_xref="GOA:A4F6P3"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6P3"
FT                   /protein_id="CAL99717.1"
FT                   /translation="MLAAGWDLLAAGMRAGLPVPVILRAVAAEFDGAPAGVLDEVARLL
FT                   ALGADAVAAWEPALRHPDTEELARAARRTARTGTGLADVAADLAADARASVGARAQAHA
FT                   QRATVWVALPLGLCFLPAFLCLGVLPVVAGMLNRIVATW"
     gtgctcgccg cgggctggga cctgctcgct gccgggatgc gggcagggct gccggtgccg        60
     gtgatcttgc gggccgttgc ggcggagttc gacggcgccc cggcgggtgt gctcgacgag       120
     gtggctcggc tgctcgccct cggtgcggat gccgtggccg cgtgggaacc cgcgctgcga       180
     caccccgata ccgaggaact cgcccgcgcc gcccgtcgga cggcgcggac cgggacaggt       240
     ctggccgacg tggcggccga cctcgccgcg gacgcgcgcg cgtccgtcgg tgcacgggct       300
     caagcccatg cccagcgggc gacggtgtgg gtcgcactgc cgttgggtct gtgcttcctg       360
     cccgcgttcc tgtgcctcgg tgtccttccg gtggtcgcag gaatgctcaa ccgcattgtc       420
     gcaacctggt ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page