(data stored in ACNUC1104 zone)

EMBL: AM420293.PE363

AM420293.PE363       Location/Qualifiers
FT   CDS_pept        408255..408491
FT                   /transl_table=11
FT                   /locus_tag="SACE_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99718"
FT                   /db_xref="GOA:A4F6P4"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6P4"
FT                   /protein_id="CAL99718.1"
FT                   /translation="MQSNLIVRSQVSTRTSRSRLLLRRLRFLLRGDDGMSTAEYAIGTL
FT                   AAAALGAILYTAVNSDTIKGAVTALLERGFAGI"
     atgcagagca acctcatcgt ccggagccaa gtttcgacgc gcacttcgcg ttcgcgattg        60
     ttgttgcggc gactccgctt tctgctgcgg ggcgacgacg ggatgagcac cgcggagtac       120
     gcgatcggca cgctggccgc ggccgcactc ggtgcgatcc tttacaccgc ggtgaacagc       180
     gacacgatca aaggggccgt aaccgctttg ctcgaacgcg gattcgcggg tatctga          237
//

If you have problems or comments...

PBIL Back to PBIL home page