(data stored in ACNUC1104 zone)

EMBL: AM420293.PE365

AM420293.PE365       Location/Qualifiers
FT   CDS_pept        410726..411382
FT                   /transl_table=11
FT                   /locus_tag="SACE_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99720"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6P6"
FT                   /protein_id="CAL99720.1"
FT                   /translation="MDWSADEWQDAIGGVRALQAGLLNNRIELRVEAIGFASRGWPVLP
FT                   GTYPVGTRWIGRDGGEADGPMPVHQDWEERLGTNPDQVAAWWSGRPHSLLLATGTAVNA
FT                   VEVDAALGYRAAVALRTLGFPVPIVAVPNGRWYFLTSGGDRLAPELADLTEVRLHGAGS
FT                   WVPMPPTTYPHGAAHWRVKPEVCGWTLPSLDFVQDALVQGLNQDHNVADLVAAGG"
     atggattggt cggcggatga gtggcaggac gccatcggcg gtgtccgggc tctccaagcc        60
     gggctgctga acaaccggat cgagctgcgg gtcgaggcga tcggcttcgc ttcgcgcggc       120
     tggccggtgc tgcccgggac ctatccggtg ggcactcggt ggatcggacg cgacggcggc       180
     gaagccgacg gtccgatgcc ggtgcaccag gactgggagg aacggctcgg gaccaacccc       240
     gaccaggtgg ccgcctggtg gtccggtcgt cctcacagcc tgctgctcgc gaccgggacg       300
     gccgtcaacg ccgtcgaggt cgacgcggcg ctcggctacc gcgccgccgt cgccctgcgc       360
     acgctgggat tcccggtccc gatcgtggcc gttcccaacg ggcgctggta tttcctgacc       420
     tccggcggag atcggctggc ccccgaactg gccgatctca ccgaggtcag gttgcacgga       480
     gccggcagct gggtccccat gccgccgacc acctacccgc acggtgcggc gcactggcgg       540
     gtcaagcccg aggtctgcgg gtggaccctg ccgtcgctgg acttcgtgca ggacgccctc       600
     gtccaaggac tcaaccagga ccacaacgtg gctgacctcg tcgcagcagg cggatga          657
//

If you have problems or comments...

PBIL Back to PBIL home page