(data stored in ACNUC1104 zone)

EMBL: AM420293.PE366

AM420293.PE366       Location/Qualifiers
FT   CDS_pept        complement(411499..413871)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0373"
FT                   /product="DEAD/DEAH box helicase-like"
FT                   /function="Distinct helicase family with a unique
FT                   C-terminal domain including a metal-binding cysteine
FT                   cluster"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99721"
FT                   /db_xref="GOA:A4F6P7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6P7"
FT                   /protein_id="CAL99721.1"
FT                   /translation="MTAESKDRGRHLLDRVLAGVPSAESPLRHVKHLPERSARTAEWPS
FT                   WVPAEVVDAYAARGVREPWVHQVEGADAVRSGQHVVVATGTASGKSMVYQLPVLSRLLE
FT                   DRTATALYLSPTKALGADQLRAVEELGLGGIRAAGYDGDTPKVDRDWVRAYGRWVFTNP
FT                   DMLHLGVLPAHSRWARFFRSLRYVVVDECHTYRGVFGSHVALLLRRLRRIAHHYGADPV
FT                   FVLASATVSDPGDLGERLTGARCRAITDDGSPRGARTVALWEPPLLEEVIGENGAPVRR
FT                   SAGSETARIMTELVIEDARTLAFIRSRRGVEVAALSAQRALAEVDSSLPDRVKAYRGGY
FT                   LPEDRRALERALLAGDLRAVATTNALELGVDIAGLDAVIVAGYPGTLASFWQQAGRAGR
FT                   DGEGALVVFVARDDPLDTYLVHHPPAVLERPVEATVLDPANPYVLEPHLACAASELPLK
FT                   EECFDAFGGAPAAEAVHALTADGVLRRRPHGWYWTERERPHRSVELRGSGGSQVAVVEG
FT                   DSGRMLGTVDPDSACATVHPGAVYLHQGESFVVDELDLNTDLALVHAESPDWTTSARES
FT                   VDISVLRTVEHRQVGPDVAVCLGDVEVTSQVVGYLRTLPSGRVLDQVPLDLPARKLVTR
FT                   AVWYTISPELLCGSAPGGAGLDPARIPGALHAAEHAAIGLLPLFATCDRWDIGGVSTAM
FT                   HADTGEATVFVHDGHPGGAGFADRGFAALFPWLAATREAIASCECPAGCPSCVQSPKCG
FT                   NGNEPLDKAGAVAVLDAVSTAGRLAGSAGLHERRQRD"
     gtgaccgcag agagcaagga caggggacgg cacctgctcg accgcgtgct cgccggggtt        60
     ccctccgccg agtcgccgct gcgccacgtc aagcacctgc cggaacgctc cgcccgcacc       120
     gcggagtggc cgtcgtgggt gccggccgag gtcgtcgacg cctacgccgc gcgcggggtc       180
     cgcgagccgt gggtgcacca ggtcgagggc gccgacgccg ttcggtccgg gcagcacgtc       240
     gtggtcgcga ccggcaccgc gtcgggcaag tcgatggtgt accagctccc ggtgctgtcg       300
     cggctgctgg aggaccgcac ggcgaccgcc ctctacctct ccccgaccaa ggcgctcggc       360
     gccgaccagc tacgcgccgt cgaggagctg gggctcggag gcattcgcgc ggccggctac       420
     gacggcgaca ctccgaaggt cgaccgcgac tgggtgcgcg cctacggccg ctgggtcttc       480
     accaatccgg acatgctgca cctcggtgtg ctgcccgccc acagccgctg ggcgcggttc       540
     ttccgcagcc tgcgctacgt cgtcgtcgac gagtgccaca cctaccgggg cgtgttcggc       600
     tcgcacgtcg cgctgctgct gcggcggctt cggcgcatcg cacaccacta cggcgcggac       660
     ccggtattcg tgctggcttc ggcgaccgtg tccgacccgg gcgacctcgg cgagcggctg       720
     accggtgccc ggtgccgggc gatcaccgac gacggttcgc cgcgcggcgc gcgcaccgtg       780
     gcgttgtggg agcctccgct gctggaggag gtgatcggcg agaacggtgc tccggtccgg       840
     cggtcggctg gttcggagac ggcgcggatc atgaccgagc tggtgatcga ggacgcccgc       900
     acgctcgcct tcatccgctc gcgacgcggg gtggaggtcg cggcgctgtc ggcccagcgc       960
     gcgctcgccg aggtcgactc gagcctgccc gaccgggtca aggcgtaccg gggcggctac      1020
     ctgccggagg accgccgtgc gctggaacgc gccctgctcg ccggtgacct gcgcgcggtg      1080
     gcgacgacga acgcgctgga gctcggggtc gacatcgccg gcctggacgc ggtgatcgtc      1140
     gcgggttacc cgggcacgct tgcctccttc tggcagcagg cgggccgggc gggccgcgac      1200
     ggcgaaggcg cgctggtggt cttcgtcgcc agggacgacc cgctggacac ctatctcgtg      1260
     caccacccgc ccgcagtgct ggaacgcccg gtcgaggcca ccgtgctcga cccggcgaac      1320
     ccgtacgtgc tcgaaccgca cctggcgtgc gccgcgtccg agcttccgct gaaggaggag      1380
     tgcttcgacg ccttcggcgg cgcacccgcg gcggaggcgg tccacgcgct caccgccgac      1440
     ggcgtgctgc ggcgacgtcc gcacggctgg tactggaccg agcgggagcg cccgcaccgc      1500
     agcgtcgaac tgcggggttc gggcggctcg caggtagcgg tggtcgaggg cgactccggc      1560
     cggatgctcg gcaccgtcga ccccgactcg gcgtgcgcca cggtgcaccc gggtgccgtc      1620
     tacctgcatc agggcgagtc gttcgtggtc gacgagctgg acctaaacac cgacctcgcg      1680
     cttgtgcacg ccgagagccc ggactggacg acttcggcgc gggagtcggt cgacatctcg      1740
     gtgctgcgga ccgtcgagca ccggcaggtg ggccccgacg tggcggtgtg cctgggtgac      1800
     gtggaggtca cctcgcaggt cgtcggctac ctgcgcacgc tgccgtcggg ccgggtgctc      1860
     gaccaggtac cgctggacct gcccgccagg aagctggtga ccagggctgt ctggtacacg      1920
     atcagcccgg agctgctgtg cggcagcgca ccggggggcg ccgggctgga tccggcgcgc      1980
     atccccggtg cgctgcatgc cgccgagcac gcggcgatcg gcctgctacc gctgttcgct      2040
     acctgcgatc gatgggacat cggcggtgtc tccaccgcca tgcacgccga caccggggag      2100
     gcgacggtgt tcgtgcacga cggtcatccg ggaggggccg gattcgccga tcgcggcttt      2160
     gccgcgctgt tcccatggct ggccgcgacg cgggaagcga tcgcttcctg cgagtgcccg      2220
     gctgggtgcc cgtcctgcgt ccagtcgccg aagtgcggga acggcaacga accgctggac      2280
     aaggcggggg cggtggctgt tctcgacgcg gtgtcgaccg cgggccggct cgccggatcg      2340
     gctgggctgc acgagcggcg tcagcgggat tga                                   2373
//

If you have problems or comments...

PBIL Back to PBIL home page