(data stored in ACNUC1104 zone)

EMBL: AM420293.PE367

AM420293.PE367       Location/Qualifiers
FT   CDS_pept        414082..414582
FT                   /transl_table=11
FT                   /locus_tag="SACE_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99722"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6P8"
FT                   /protein_id="CAL99722.1"
FT                   /translation="MTRHFAGSRGGWTGRCGSGGDARTRSRSRPRFSTPCWRPCPKRYT
FT                   ARGRRVGIGWTRGCPWRHAVRVRRIGIGWPTTAPGAPHRRGRRTDNRCASAPPVAPRRS
FT                   GPSYRRRLANDGARSAARRAAASPSIASACAAAIRHRGAMRRALGAGCPRQTLPPHPYR
FT                   EPA"
     ttgaccaggc atttcgccgg gtcgcgaggc ggctggacgg gccgatgcgg ctctggaggc        60
     gacgcccgga cgcgcagtcg ctcgcgccct cgattctcga cgccgtgttg gcgaccttgc       120
     ccgaagcgct acaccgcccg aggtcgccgc gtcggcatcg gctggacacg cggttgcccg       180
     tggcgccacg ccgtccgggt ccgtcgtatc ggcatcggct ggccaacgac ggcgcccgga       240
     gcgccgcacc gtcggggccg ccgcaccgac aacagatgcg caagcgcgcc gcccgtggcg       300
     ccacgccgtt cgggtccgtc gtatcgacgt cggctggcca acgacggcgc ccggagcgcc       360
     gcccgtcggg ccgccgcgtc gccgtccatc gcatcggcct gcgccgccgc cattcgacat       420
     cgcggcgcga tgcgccgcgc cctcggtgcc gggtgccctc ggcagaccct cccgccccat       480
     ccgtaccggg agcccgcata g                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page