(data stored in ACNUC1104 zone)

EMBL: AM420293.PE369

AM420293.PE369       Location/Qualifiers
FT   CDS_pept        417544..418128
FT                   /transl_table=11
FT                   /locus_tag="SACE_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99724"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Q0"
FT                   /protein_id="CAL99724.1"
FT                   /translation="MDQLSFFSAEARHPRIADLAGLLCGPGQAVGFGRGTAARLSVVVD
FT                   DAWRARSLVLACADRGVDAELGRSDEGRPLVRTAFRADLTELARHWLRGAVKSVPADFA
FT                   PDGCALRLWALTAGRLEPGGYLLGLDPHAPETHEPLVAALARSGLPARFIGARAGGPAL
FT                   RVTGKRRIARLAELVGPVPDGAIERTWPLVS"
     gtggaccagc tgtccttctt ctcggctgag gcccggcacc cccgcatcgc cgacctggcg        60
     gggctgctgt gcgggccggg acaggccgtg gggttcgggc gcggcaccgc ggcgcggctc       120
     tcggtcgtgg tcgacgacgc gtggcgggcc cggtcgctgg tcctggcgtg cgcggaccgc       180
     ggcgtggacg ccgagctggg ccgctccgac gagggccgtc cgctcgtgcg caccgccttc       240
     cgcgccgacc tcaccgagct cgcccgccac tggctgcgcg gtgcggtgaa gtcggtgccc       300
     gccgacttcg cgccggacgg ctgcgcgctg cggctctggg cgctgaccgc cggccgactg       360
     gagcccggcg gctacctgct gggcctggac ccgcacgccc ccgagacgca cgaaccgctg       420
     gtcgcggcgc tggcccgcag cggtctgccc gccaggttca tcggcgcccg ggccggcgga       480
     ccggcactgc gggtgacggg caagcgccgg atcgcccggc tggcggagct ggtcggaccg       540
     gtgcccgatg gtgcgatcga gcgaacgtgg ccgctggtgt cctga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page