(data stored in ACNUC1104 zone)

EMBL: AM420293.PE37

AM420293.PE37        Location/Qualifiers
FT   CDS_pept        55548..55703
FT                   /transl_table=11
FT                   /locus_tag="SACE_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99392"
FT                   /db_xref="GOA:A4F5R8"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5R8"
FT                   /protein_id="CAL99392.1"
FT                   /translation="MYGWIWRRLPGPTAAKAVQAVLLVAAVIALLLFVVFPRVEPLLPF
FT                   NEVTTL"
     atgtacggct ggatctggcg gcggttgccg ggccccaccg cggcgaaggc cgtccaggcc        60
     gtgctgctgg tcgcggcggt catcgcgctg ctgctgttcg tggtcttccc gcgggttgag       120
     ccgctgctgc cgttcaacga ggtcaccacg ctctga                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page