(data stored in ACNUC1104 zone)

EMBL: AM420293.PE371

AM420293.PE371       Location/Qualifiers
FT   CDS_pept        421334..421684
FT                   /transl_table=11
FT                   /locus_tag="SACE_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99726"
FT                   /db_xref="GOA:A4F6Q2"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Q2"
FT                   /protein_id="CAL99726.1"
FT                   /translation="MRDALSGPDGTQPLAPPPTYPDVLGGGEIVRSHIRPAQPVAPPRL
FT                   TEHERAAAVRPRRAARHPAKQTEVRVEPASDQRAGGVAGKVVGCLTMLVVLGGIALGVV
FT                   HRLLVEYGILGP"
     atgcgagacg ccctgtccgg cccggacggc acgcagccgt tggcgccacc gccgacgtat        60
     ccggacgtgc tcggtggcgg tgagatcgtc cgcagccaca tccggccggc gcagccggtg       120
     gcgcctccac ggctgaccga gcacgagcgt gcggccgcgg tgcggccccg gcgtgcggcc       180
     cggcatccgg cgaagcagac ggaagtgcgc gtcgagcccg cgagcgacca gcgcgcgggc       240
     ggtgtggcgg gcaaggtcgt cggatgcctg acgatgctgg tcgtgctggg tgggatcgcg       300
     ctgggagtgg tccaccgcct gctggtggag tacggaatcc tcgggccgtg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page