(data stored in ACNUC1104 zone)

EMBL: AM420293.PE374

AM420293.PE374       Location/Qualifiers
FT   CDS_pept        complement(423996..425381)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99729"
FT                   /db_xref="GOA:A4F6Q5"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Q5"
FT                   /protein_id="CAL99729.1"
FT                   /translation="MRRLAVCTTASLAVAGLSLPAALAPEALLSDALAQESTLPTTPRP
FT                   SPHDPTQPPESVPVPQPGPIVADAGTGIGMIRILPKTVPTGTILDNPAFEESLPKQALA
FT                   ELGMGLASAQANSGAYLAHERAVADAQPFGFAVQGKAPRSPLSLSQTAVPDHAEPTVNE
FT                   LQPPASPLDGLVKLGVLEGSAHARWDKVLGPCVEPIADARTSLAGVSAGNALPSFPAEL
FT                   TGLTGAAGGASLLNVPNAMQAHSNVRLVDVPGQRGKAVRATSRMSVASVRLFAGTDREL
FT                   RIDVISEPTLTATSTGDPMTSTVEYQAPVLRISQGGEEIGTIDAAKPRMDLPFDPRKLD
FT                   LGVVRLSIGELRQDVVGSEVRAGARMFDLHILPADRLGIPTSLAQISFGEQVARAGAPE
FT                   GGVVCEAAPATNPDPAPIAEGPKAPPLALTSGAYSAVPLFWTGTAMLLLGTILVAAMPR
FT                   RRN"
     atgcgccgct tggcggtctg cacgacggcg tcgctggccg tcgccgggct gagcctgccc        60
     gccgcgctcg caccggaggc gctgctgtcg gacgcgctgg cccaggagtc gacgttgccg       120
     acgacgccgc gaccgtcgcc gcacgacccg acgcagcccc cggagtcggt gccggtgccg       180
     cagccgggtc cgatcgtggc cgacgcgggc accggcatcg gcatgatccg catcctgccc       240
     aagacggttc ccaccggcac gatcctcgac aacccggctt tcgaggagtc cctgccgaag       300
     caggccctcg ccgagctggg catgggtctg gccagcgcgc aggcgaactc cggcgcgtac       360
     ctggcgcacg agcgcgcggt ggccgacgcc cagcccttcg ggttcgccgt ccagggcaag       420
     gcgccgcgct caccactgtc gctgagccag accgcggtgc ccgaccacgc cgagccgacg       480
     gtgaacgagc tccagccgcc ggcctcgccg ctggacgggc tggtcaagct cggcgtgctc       540
     gaaggcagcg cgcacgcccg gtgggacaag gtgctggggc cgtgcgtgga gccgatcgcc       600
     gatgccagga cctcgctggc cggcgtgtcg gcgggtaacg cgctgccgtc gttcccggcc       660
     gagctgaccg gcctgaccgg tgcggcgggc ggcgcgtcgc tgctgaacgt cccgaacgcg       720
     atgcaggcgc actcgaacgt ccggctcgtc gacgttcccg gccaacgggg caaggcggtc       780
     cgggccacct cgcggatgag cgtcgcgagc gtccggttgt tcgccggaac cgaccgcgag       840
     ctgcgcatcg acgtcatcag cgagccgacg ctgacggcga cctcgaccgg cgatccgatg       900
     acgtccactg tggagtacca ggcgccggtt ctgcggatct cccagggcgg cgaggagatc       960
     gggacgatcg atgccgccaa gccgcggatg gacctgccgt tcgacccgcg caagctcgat      1020
     ctcggcgtcg tgcggctcag catcggcgag ctgcgccagg acgtcgtggg ttccgaggtg      1080
     cgggccgggg cgcggatgtt cgacctgcac atcctgcccg cggaccggct cggcatcccg      1140
     acctcgctgg cgcagatctc cttcggcgag caggtggcca gggcaggcgc gccggaaggc      1200
     ggagtggtct gcgaagccgc cccggcgacc aaccccgatc ccgcgccgat cgcggagggt      1260
     ccgaaggcgc cgccgctcgc gctgaccagc ggcgcctact ccgcggtgcc gctgttctgg      1320
     accgggacgg cgatgctgct gctgggcacg atcctggtcg ccgccatgcc gagacgccgg      1380
     aactga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page