(data stored in SCRATCH zone)

EMBL: AM420293.PE376

AM420293.PE376       Location/Qualifiers
FT   CDS_pept        complement(426590..427030)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99731"
FT                   /db_xref="InterPro:IPR011944"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Q7"
FT                   /protein_id="CAL99731.1"
FT                   /translation="MTAVDEVLTEMARAWNAGDGTAWAANFAEDADFVDVVGRVQRGRE
FT                   VIAAEHQKIFDTIYQGSHLEIRQVGSRPLDDRTLLVHTASTLRVPAGPRAGEWHAIQTK
FT                   VFRDGRILAFHNTGRVDLADFAHHDEALADRAPQEWGQIASG"
     gtgacagcag tggacgaggt gctcaccgag atggcgcgcg cgtggaacgc cggcgacggc        60
     accgcatggg cggcgaactt cgccgaggac gccgacttcg tcgacgtggt cgggcgcgtg       120
     cagcgcggcc gggaggtcat cgccgcggag caccagaaga tcttcgacac catctaccag       180
     ggcagccacc tggagattcg gcaggtcggc agccgtcccc tcgacgaccg caccctgctg       240
     gtgcacaccg cgtcgacgct gcgcgtcccc gcaggcccgc gcgccggcga gtggcacgcc       300
     atccagacga aggtcttccg cgacggccgg atcctggcct tccacaacac cggccgcgtg       360
     gacctggccg acttcgcgca ccacgacgaa gccctggccg accgcgcgcc ccaggagtgg       420
     ggccagatcg cgtcgggctg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page