(data stored in SCRATCH zone)

EMBL: AM420293.PE380

AM420293.PE380       Location/Qualifiers
FT   CDS_pept        431003..431719
FT                   /transl_table=11
FT                   /locus_tag="SACE_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99735"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6R1"
FT                   /protein_id="CAL99735.1"
FT                   /translation="MKRSLSAAAAVLAGGAGVAGLAGAATAAEMPEFGIDMPVQGKDTV
FT                   LATSNFTGALQSAHKMVGDVVPASPTASRSDTPHPLGPAGELNSTDPVGGVLNPLVGQV
FT                   ATPKTASPFDIVGGVLPHGQQLPVNMPAGRTSPNPVNGVIDPLMGEGGGSPLGGPVGGA
FT                   VDALGTSNGSTPVVGDALNQSTPVQHPMGRSTAGPLVAVAHTLADATGQSPDATGVHKA
FT                   AGNVLANGPLSGNIGA"
     atgaaacgca gcctgagcgc cgcggccgca gttctggccg gaggcgccgg cgtagccggc        60
     ctcgccggcg ccgccaccgc agccgagatg ccggagttcg gcatcgacat gcccgtgcag       120
     ggcaaggaca ccgtcctcgc cacgtccaac ttcacgggcg cgctgcagag cgcgcacaag       180
     atggtcggcg acgtggtgcc cgcgagcccg accgcgagcc gctcggacac cccgcacccg       240
     ctcggcccgg ccggtgagct gaacagcacg gacccggtcg gcggggtgct caacccgctg       300
     gtcggccagg tggccacccc gaagaccgcc tccccgttcg acatcgtcgg cggcgtcctg       360
     ccgcacgggc agcagctccc ggtgaacatg ccggcgggcc gcacctcgcc caacccggtc       420
     aacggcgtga tcgacccgct gatgggcgag ggcggcggtt ccccgctcgg cggcccggtc       480
     ggcggagccg tggacgccct cggcaccagc aacggcagca ccccggtggt cggcgacgcg       540
     ctgaaccagt ccaccccggt ccagcacccg atgggccgga gcaccgcggg cccgctggtc       600
     gcggtcgccc acacgctcgc ggacgccacc gggcagagcc ccgacgcgac gggcgtgcac       660
     aaggccgccg gcaacgtgct ggccaacggc ccgctcagcg gcaacatcgg agcctga          717
//

If you have problems or comments...

PBIL Back to PBIL home page