(data stored in ACNUC1104 zone)

EMBL: AM420293.PE385

AM420293.PE385       Location/Qualifiers
FT   CDS_pept        437872..441666
FT                   /transl_table=11
FT                   /locus_tag="SACE_0392"
FT                   /product="hypothetical protein"
FT                   /function="D-alanyl-D-alanine carboxypeptidase
FT                   (penicillin-binding protein 4)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99740"
FT                   /db_xref="GOA:A4F6R6"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6R6"
FT                   /protein_id="CAL99740.1"
FT                   /translation="MPDPQTTRGEVSEPEAEPQADATGAGASDATASGASSAKTQTRTG
FT                   TLDDVTADAAGGEAAGAEEDGGDDAEKSADEGESSGTTGGDDDRTAADDDAAEGEAAGA
FT                   GDQGADSEAGESGSANGGGQLRGRFKGQFTAGGPMNGQLTGQLTGRMDGPMSGRIDGQI
FT                   DTEKSEEAGKSEQADASGESDDAVESDQAGKSGEAAERGSDEATTEPEDSGDEADDSGA
FT                   DSAEAAEDAETDEPAEAAEAAESAADAGESADASEEQPTESAASEDAGSAEDGEADESS
FT                   AGEREDAQTAAGEDADAADQSVTADDSTADETEAADDEAGESETSSTDTVALGTVQPES
FT                   DEDGETSESGTAEWEAESEAGETEASETGPAEDESSEAEVADEAEAAEEAEAADTAAEP
FT                   ETADSAAAETTSATESDSPEPESESSEPESDEAETAEPTPDSEAAEDEPAQAEAAPSPE
FT                   EPEAVADEDAETEAAGTETAAEAGTAAERDADEWPTDEHERVEAEPETREPVEQAEEAE
FT                   ESAEPAAEEPAQAAVEEPGLTAPGEPEAAPAEPEQATAPEAEQAAPAEPEQSEQAPEES
FT                   EQAADQQAPAVEPEQQRPAAPPERSVEQTQQFRPVEQTQWIPRIEQTQQIQRIEPEREE
FT                   PAEATSGEDAGPPTDPGPSKPSPQLDQGPPTMRIPAVGAAPSVDGPPTQRIPLVPPPGS
FT                   AEQTQQFARPDFSSPPRSAQPQDFDTSSARTAQPHDFAGLTGPAPAPAAPQVPQPPDVT
FT                   RQAPAPTHQPPPAPAQQSYVPGATQPVAKPAPEASPEPHPAEPPAEPSAAAPAKRRKRR
FT                   GTLITVALLLVVGLGAGIAFGPALVRALTEAQIAEPPAPVRLQPSIKPLDDGAPLPRQQ
FT                   RVSAALAGPLANPALGTFGGTVIDAQTGAPVWQQSPGQALTPASTGKLLTMSAALLALD
FT                   HQQRFSTKVVRGPEPGSVVLVGGGDPTLSTLGPGEDTVYTGAARIDDLAEQVRKATGGS
FT                   VSRIYVDVGRYSGPKMAPGWLPEDVQAGYVAPMEPLMLNGGRADPTKDTSPRTQTPALQ
FT                   AGQRLASKLGTGSVQEGNAPVNAQVLGEVKSPPVQDMAEIVLQHSDNVLAEALAREVAI
FT                   ATGNEPSFAGASKAVREVLQRNGFDLSGNTMVDGSGLSLDDRVTPQLLGSLLAAATAPA
FT                   GPEGGLEPKSAKLRALLPGLPVAAGSGSLHDRYTDSSGRGWVRAKTGTLDGANSLAGTV
FT                   VTENGRLLVFALMSNGTMSAQARPALDDLAIALRDCGCD"
     gtgcccgacc cccagacgac caggggtgag gtgtccgaac ccgaagccga accgcaggcg        60
     gacgccacgg gtgcgggcgc gagtgacgcc acggcttcgg gcgcgagtag cgcgaagacg       120
     cagacgcgga ccgggacgct ggacgacgtg actgcggatg cggcgggcgg cgaagcggcg       180
     ggtgcggaag aggacggcgg cgacgacgcg gagaagtccg ctgacgaagg cgagtcctcc       240
     ggtacgaccg gcggagacga cgaccggacg gccgctgacg atgacgcggc tgaaggggag       300
     gccgccggag ccggcgacca gggggctgac tcggaggcgg gcgaatctgg ttccgcgaat       360
     ggtggcggtc agctgcgtgg gcggttcaag ggccagttca cggccggcgg gccgatgaac       420
     ggtcagctca ccggtcagct cacaggccgg atggacggac cgatgagcgg ccgcatagac       480
     ggccagatcg acaccgagaa gtcggaagaa gcggggaagt cggaacaagc cgacgcgtcc       540
     ggggagtcgg acgacgctgt ggagtccgac caggcgggga agtccggcga ggcagcagag       600
     cgcgggtccg acgaggccac cacggagccg gaggactccg gcgacgaggc cgacgactcc       660
     ggtgcggact ccgccgaggc ggcagaggac gcggagaccg acgagccggc ggaggccgcg       720
     gaggcggcgg agtccgccgc ggacgccggc gagtcggcgg acgcgtccga ggagcagccg       780
     acggagtcgg cggcgtccga ggatgcgggc tcggcggagg acggcgaagc cgacgagtcg       840
     tcggccgggg agcgcgagga cgcccagacc gcggccggtg aggacgccga cgccgcggat       900
     cagtcggtca ccgctgacga ctcgacggct gacgagaccg aggcagcgga cgacgaggcc       960
     ggggagtccg agacctcctc gactgacacc gtcgcactcg ggaccgttca gcccgaatcg      1020
     gacgaggacg gcgagacatc cgagtccgga accgctgagt gggaagccga atccgaggca      1080
     ggcgaaaccg aagcttcgga gaccggacca gccgaagacg agtcctcgga agcagaggtc      1140
     gctgacgaag cagaggccgc tgaggaagca gaggccgctg acactgcggc cgagcccgag      1200
     acggccgact ccgcggcagc cgaaaccacc agtgctaccg agtccgactc ccccgagccg      1260
     gagtccgagt cctccgagcc ggagtccgac gaggccgaga ccgccgagcc gacccccgac      1320
     tcggaggccg ctgaggacga gcccgctcag gccgaggcag ccccctcccc ggaggagccg      1380
     gaggctgtcg ccgacgagga cgccgagacc gaagccgccg ggaccgagac tgccgccgag      1440
     gctgggaccg ctgccgagcg ggacgccgac gagtggccga ccgacgagca cgagcgcgtc      1500
     gaggcggagc cggagacccg cgagccggtc gagcaggctg aggaagccga agagtccgcg      1560
     gagcccgcag ccgaggagcc cgcgcaggcc gcggtcgagg aacccgggct caccgccccc      1620
     ggtgagcccg aggccgcccc cgccgaaccc gagcaggcga cagcgccgga agccgagcag      1680
     gcggcgccag ccgagcccga gcagtccgag caggcgcccg aggagtccga gcaggccgcc      1740
     gaccagcagg ctccggccgt cgagcccgag cagcagcgtc ccgccgcccc gccggagcgc      1800
     agcgtcgagc agacccagca gttccgcccg gtcgagcaga cgcagtggat cccgcggatc      1860
     gagcagacgc agcagatcca gcggatcgag ccggagcggg aggaacccgc cgaggccacc      1920
     agcggcgagg acgccggtcc gccgaccgac cccgggccct cgaagccgtc gccgcagctc      1980
     gaccagggac cgccgacgat gcggatcccc gccgtcggtg cggctccgag cgtcgacggt      2040
     ccgccgacgc agcgcatccc gctggtgccg ccgcccggct ccgccgagca gacgcagcag      2100
     ttcgcgcgac ccgacttcag cagtccgccg cggagcgcgc agccgcagga cttcgacacg      2160
     tcgtcggcgc gcaccgcgca gccccacgac ttcgccgggc tgaccgggcc ggccccggcg      2220
     ccggcagcgc cgcaggttcc gcagccgcct gacgtcactc ggcaggcccc ggcaccgacc      2280
     caccagccgc cgcccgcgcc cgcccagcag tcgtacgttc ccggcgcgac gcagcccgtc      2340
     gccaagccgg cgcccgaggc ttccccggag ccgcaccccg ccgagccacc agccgagccg      2400
     tccgctgccg cgcccgccaa gcgccggaag cgccgcggga cgctgatcac cgtcgccctg      2460
     ctgctggtcg tcggcctcgg cgcgggcatc gcgttcggcc cggcgctggt gcgcgcgctg      2520
     accgaggcgc agatcgccga gccgcctgca ccggtccggc tccagccgtc gatcaagccg      2580
     ctcgacgacg gcgccccgct gccccgccag cagcgcgtgt cggccgcgct ggccggtccg      2640
     ctggccaacc ccgcgctggg cacgttcggc gggacggtca tcgacgcgca gaccggcgcg      2700
     ccggtgtggc agcagagccc aggccaggcc ctcaccccgg cctcgaccgg gaagctgctg      2760
     accatgagcg ccgccctgct cgcgctcgac caccagcagc gcttcagcac caaggtggtg      2820
     cgcggtcccg agccgggcag cgtcgtgctc gtcggcggcg gcgacccgac gctgtcgacc      2880
     ctggggccgg gcgaggacac cgtctacacc ggggcggcgc gcatcgacga cctggccgag      2940
     caggtccgca aggccaccgg cgggtccgtc tcgcgcatct acgtcgacgt cggccgctac      3000
     tccgggccga agatggcgcc gggctggctg cccgaggacg tccaggcggg ctacgtcgcc      3060
     ccgatggagc cgctgatgct caacggcggt cgcgccgacc cgaccaagga caccagcccg      3120
     cgcacccaga cgcccgcgct ccaggcgggg cagcggctgg catcgaagct cggcaccggc      3180
     agcgtccagg agggcaacgc gccggtgaac gcgcaggtcc tcggcgaggt gaagtccccg      3240
     ccggtgcagg acatggccga gatcgtgctc cagcactccg acaacgtgct ggccgaggcg      3300
     ctggccaggg aggtcgcgat cgccaccggc aacgagccgt ccttcgcggg ggcttccaag      3360
     gcggtgcgcg aggtgctcca gcgcaacggc ttcgacctct cgggcaacac gatggtcgac      3420
     ggcagcggcc tctcgctgga cgaccgcgtc accccgcagc tgctcggctc gctgctggcg      3480
     gcggcgaccg cccccgcggg gccggagggc gggctcgagc ccaagagcgc gaagctgcgc      3540
     gcgctgctgc cggggctgcc ggtggccgcg ggcagcggca gcctgcacga ccgctacacc      3600
     gacagctccg gacgcggctg ggtgcgggcc aagaccggga cgctggacgg cgcgaacagc      3660
     ctcgcgggca ccgtcgtcac cgagaacggc aggctgctgg tgttcgcgct gatgtccaac      3720
     ggcaccatgt ccgcgcaggc ccggcccgct ctcgacgatc tcgccatcgc cctgcgcgac      3780
     tgcggctgcg actga                                                       3795
//

If you have problems or comments...

PBIL Back to PBIL home page