(data stored in SCRATCH zone)

EMBL: AM420293.PE386

AM420293.PE386       Location/Qualifiers
FT   CDS_pept        441855..442823
FT                   /transl_table=11
FT                   /locus_tag="SACE_0393"
FT                   /product="hypothetical protein"
FT                   /function="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99741"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR022454"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6R7"
FT                   /protein_id="CAL99741.1"
FT                   /translation="MRSLRRYSVEAETHVRELTGLGTHLPVLEGDVVDRPDWVRGAAHG
FT                   LAELTDAALSNAHGVQREGLDLLGGISTRGAGVQAGIVLAYLGGKVLGQYDPFGPTASG
FT                   QPGRLLLVAPNIVAAHQALEVPGEDFRMWVCLHESTHRLQFTAVPWLRDHFAASLGTLL
FT                   SEMEGTTSDLLGRLPAVVREVRSGRGGDSSPGVLGVIELLQTPRQRAALDRIIAISTLL
FT                   EGHADHVMDAVGPRVVPSVATIRQRFTERRKGGGLLDRILRSLLGVDAKIHQYAQGAAF
FT                   TRHVVDQVGMEGFNAVWAAPDHLPTRAEITAPATWLRRVHG"
     gtgcgctcgc tgcgccgcta cagcgtggaa gccgagacgc acgtccgcga gctgaccggg        60
     ctcggcaccc acctgccggt gctcgagggc gatgtcgtcg accggccgga ctgggttcgg       120
     ggtgcggcgc acgggctcgc cgagctgacc gacgccgcgc tgtccaacgc gcacggcgtg       180
     caacgcgagg gactcgacct gctgggcggc atcagcaccc ggggagccgg cgtgcaggcc       240
     gggatcgtgc tggcctacct cggcggcaag gtgctcgggc agtacgaccc cttcgggccg       300
     accgcgagcg ggcagcccgg caggctgctg ctggtcgcgc cgaacatcgt cgcggcgcac       360
     caggcgctgg aggtgccggg cgaggacttc cggatgtggg tctgcctgca cgagtcgacc       420
     caccggttgc agttcaccgc agtgccgtgg ctgcgcgacc acttcgccgc ctcgctcggc       480
     acgctgctct ccgagatgga gggaaccacc agcgacctgc tcggccggtt gcccgccgtc       540
     gtgcgcgagg tgcgctccgg tcgcggtggt gactccagtc ccggtgtgct gggcgtgatc       600
     gagctgctgc agaccccgcg gcagcgcgcc gcgctcgacc ggatcatcgc gatctcgacg       660
     ctgctggagg gccacgccga ccacgtgatg gacgccgtcg gcccgcgcgt ggtgcccagc       720
     gtcgccacca tccggcagcg cttcaccgag cgccgcaagg gcggcgggct gctcgaccgg       780
     atcctgcgca gcctgctcgg ggtggacgcc aagatccacc agtacgccca gggcgccgcg       840
     ttcaccaggc acgtcgtcga ccaggtcggc atggagggct tcaacgccgt gtgggccgcg       900
     cccgaccacc tgccgacccg cgcggagatc accgctcccg ccacctggct ccgccgcgtc       960
     cacggctga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page