(data stored in ACNUC1104 zone)

EMBL: AM420293.PE387

AM420293.PE387       Location/Qualifiers
FT   CDS_pept        443116..444108
FT                   /transl_table=11
FT                   /locus_tag="SACE_0394"
FT                   /product="cell cycle protein MesJ"
FT                   /function="predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /EC_number="6.3.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99742"
FT                   /db_xref="GOA:A4F6R8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6R8"
FT                   /protein_id="CAL99742.1"
FT                   /translation="MPPTAAVTATRAAVRRLLGSAEASPSAPLGAVAVACSGGADSLAL
FT                   AAATTHVARRRDIAVHGLVVDHGLQEGSADVASRAAEQLEELGCDVVRVLPVEIGREGG
FT                   PEAAARRARYAALDAARPAGAPVLLGHTRDDQAETVLLGLGRGSGARSIAGMRPVDLPW
FT                   LRPFLDVTRDTTLAACEALGLRPWQDPHNSDAKFTRVRLRAEVLPLLEEVLQGGVASAL
FT                   ARTAVQLREDADALDEVAADVRKRVEDGDALDAAALSAGPPAVRRRVLRGWLLDQGVRE
FT                   VSDAHLRAADALVGHWKGQGPHALPGGFVLRRTHGTLRVEVAVKQPPDY"
     gtgcctccca ccgccgccgt caccgccacg cgagccgccg tccggcggct cctcggctcc        60
     gccgaggcgt cgccgtccgc gccgctcggc gcggtcgcgg tggcgtgctc cggcggcgcc       120
     gactcgctgg cgctcgcggc cgccaccacg cacgtcgccc ggcggcggga catcgccgtg       180
     cacggtctcg tcgtcgacca cgggctccag gagggctccg ccgacgtggc gagccgggcg       240
     gcggagcagt tggaggagct ggggtgcgac gtcgtccgcg tgctgccggt cgaaatcggt       300
     cgcgagggtg gtccggaggc cgccgcgcgg cgggctcgct acgcggcgct cgatgccgcc       360
     cgccccgccg gcgcgccggt cctgctcggg cacacccgcg acgaccaggc cgaaacggtt       420
     ctgctcgggc tcggcagggg atcgggtgcg cggtcgatcg cgggcatgcg cccggtcgac       480
     ctcccgtggc tgcggccttt cctcgacgtg acaagggaca cgacgctggc cgcgtgcgag       540
     gcgctcgggc tgcggccgtg gcaggacccg cacaactcgg acgcgaagtt cacccgcgtc       600
     cggctgcgcg cggaggtgct cccgctgctg gaggaggtcc tccagggcgg tgtggcctcc       660
     gcgctggcgc gcaccgcggt gcagttgcgg gaggacgccg acgccctcga cgaggtggcc       720
     gccgacgtgc ggaaacgggt cgaggacggc gacgcgctcg acgccgcggc cctgtcggcc       780
     ggcccgcccg cggtgcggcg ccgggtcctg cgcggctggc tgctcgacca aggtgtccgg       840
     gaggtgtccg acgcccacct ccgggccgcc gacgcgctgg tcggccactg gaagggacag       900
     ggaccacatg cgttgccggg cggctttgtg ctgcgccgga cccatggcac gcttcgggtg       960
     gaagtggcgg tcaagcaacc gccggattac tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page