(data stored in SCRATCH zone)

EMBL: AM420293.PE395

AM420293.PE395       Location/Qualifiers
FT   CDS_pept        450977..451441
FT                   /transl_table=11
FT                   /locus_tag="SACE_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99750"
FT                   /db_xref="GOA:A4F6S6"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6S6"
FT                   /protein_id="CAL99750.1"
FT                   /translation="MSFTKPRQLVAAALVAAVLVYLLVRMAYGVLPQLPTFAGATLLLI
FT                   ALIDVVFALTMRPRLKRKPGTEPVDPLTAARAVALAKASSLAGAIMGGVWVGLLAYLLP
FT                   ERGTVQAAGADTVAAVIGLVSAAALVAAGLWLEHCLRNPDEPEEPLDDED"
     atgtccttca ccaaaccgcg gcaactggtg gcggctgccc tggtcgcggc ggtcctggtc        60
     tacctgctcg tccggatggc ctacggggtg ctgccgcagc tgccgacgtt cgccggggcg       120
     accctgctgc tgatcgcgct gatcgacgtc gtgttcgcgc tgaccatgcg tccgcggctc       180
     aagcgcaagc cgggtaccga gccggtcgac ccgctgacgg cggcgcgcgc ggtggcgctg       240
     gcgaaggcgt cgtcgctggc cggggcgatc atgggcggtg tgtgggtcgg cctgctggcc       300
     tacctgctgc cggagcgcgg gaccgtgcag gcggccggcg ccgacaccgt cgcggcggtg       360
     atcgggctgg tcagcgcggc cgcgctggtc gcggcggggt tgtggctgga gcactgcctg       420
     cgcaacccgg acgagcccga ggaaccgctc gacgacgagg actga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page