(data stored in SCRATCH zone)

EMBL: AM420293.PE397

AM420293.PE397       Location/Qualifiers
FT   CDS_pept        452922..454628
FT                   /transl_table=11
FT                   /locus_tag="SACE_0404"
FT                   /product="putative integral membrane protein"
FT                   /function="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99752"
FT                   /db_xref="GOA:A4F6S8"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6S8"
FT                   /protein_id="CAL99752.1"
FT                   /translation="MSTPDLREPAPDLSGARRLQTRKHHVVGWPIAGLIVLGICGLVMV
FT                   GVTTSRVGSLPALVGAVAALLPVGVVFAAIVWIDRWEPEPPLLLLGAFLWGAGGATACA
FT                   LMLNDAVTGLGDLLLGANDHRFFSLAVMAPLVEEAAKALFVVGLWFRRRAEFNGMVDGI
FT                   VYAALTAAGFAFTENILYFGKAFAEGGLGGVSGGVVAVFILRGVLAPFSHPLFTAMVGI
FT                   GIGLASRTTNGRMRVLWPVFGFLAAVVLHAVWNASTLLGGVEFLNIYFLFMVPIFFGTG
FT                   WIVLWQRKREQRIVAEQLPVLQRAGLIVRSEVEMLASLAGRRGWLRKVRRSAGGDAAKA
FT                   VRDYQIAVTELAFLQHRASEGRTTSAVRRARREKLIEDLKHARRSAAGSQQAIQTARIK
FT                   IHELTQLNLKRPRRSEGPVRPKRSTPVGPPIHGTPPAQGQGPVPAQERGPHHASPDHGP
FT                   FPSQDQGRFPSQDQVPPFPSQDQVPPFPSQDQAPFPSQDQGRFPSQDQVPPFPSQERGP
FT                   HQPQAQGRARDHRQVPPPQERGPGQAPRGAVPPEHGSRRPPENGPVPPPGG"
     gtgtccactc ctgatcttcg ggagccggcg cccgacctct ccggggcgcg ccggctccag        60
     acccgcaagc accacgtcgt cgggtggccg atcgcgggcc tgatcgtgct cgggatctgc       120
     ggcctggtga tggtcggcgt gacgacctcc agagtcggat cgctgcccgc tctcgtaggc       180
     gcggtcgccg cgctgctgcc ggtcggggtg gtcttcgccg cgatcgtgtg gatcgaccgc       240
     tgggagccgg agccgccgct cctgctgctc ggcgcgttcc tgtggggagc agggggagcc       300
     accgcgtgcg cgctgatgct caacgacgcc gtcaccgggc tgggtgacct gctgctgggg       360
     gccaacgacc accgcttctt cagcctggcc gtgatggcgc cactggtgga ggaggccgcc       420
     aaggcgctgt tcgtggtggg cctgtggttc cgccgccggg ccgagttcaa cgggatggtc       480
     gacggcatcg tctacgcggc gctgaccgcg gcgggcttcg ccttcaccga gaacatcctg       540
     tacttcggca aggccttcgc cgagggcggc ctcggcggcg tcagcggcgg cgtggtcgcg       600
     gtgttcatcc tgcgcggggt gctcgcgccg ttctcgcacc cgctgttcac cgcgatggtc       660
     ggtatcggga tcggtctcgc ctcgcggacc accaacggcc ggatgcgggt gctgtggccg       720
     gtgttcgggt tcctcgccgc cgtggtgctg cacgcggtct ggaacgcgtc gacgctgctc       780
     ggcggggtcg agttcctcaa catctacttc ctgttcatgg ttccgatctt cttcggcacc       840
     gggtggatcg tgctctggca gcgcaagcgc gagcagcgga tcgtcgccga gcagctcccg       900
     gtgctgcagc gcgccgggct gatcgtgcgc agcgaggtcg agatgctggc gagcctggcc       960
     gggcgccggg gctggctgcg caaggtccgc cgcagcgcgg gcggcgatgc cgccaaggcg      1020
     gtccgcgact accagatcgc cgtcaccgag ctggcgttcc tccagcaccg cgcgtccgag      1080
     gggcgcacca ccagcgccgt ccgccgggcg cggcgggaga agctgatcga ggacctcaag      1140
     cacgcgcggc ggtcggccgc gggcagccag caggcgatcc agaccgcgcg gatcaagatc      1200
     cacgagctga cccagctcaa cctcaagcgc ccgcgccggt cggaggggcc ggtgcgtccg      1260
     aagcggagca ctccggtcgg cccgccgatc cacggaacgc ctccggcgca gggccagggg      1320
     ccggtgcccg cgcaggagcg cgggccgcac cacgcctccc cggaccacgg cccgttcccg      1380
     tcgcaggacc aaggccggtt cccgtcccag gaccaggtcc cgccgttccc gtctcaggac      1440
     caggtcccgc cgtttccgtc tcaggaccag gccccgttcc cgtcgcagga ccaaggccgg      1500
     ttcccgtccc aggaccaggt cccgccgttc ccctcccagg agcgtggccc gcaccagccc      1560
     caggcccagg gccgggccag ggaccaccgc caggtcccgc cgccgcagga gcgcggtccc      1620
     ggccaggcgc cgcgcggtgc ggtgccgccc gagcacgggt cgcgtcgtcc gccggagaac      1680
     gggccggttc cgccgccggg cggctga                                          1707
//

If you have problems or comments...

PBIL Back to PBIL home page