(data stored in ACNUC1104 zone)

EMBL: AM420293.PE411

AM420293.PE411       Location/Qualifiers
FT   CDS_pept        complement(470606..471682)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0418"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /function="NADH dehydrogenase, FAD-containing subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99766"
FT                   /db_xref="GOA:A4F6U2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6U2"
FT                   /protein_id="CAL99766.1"
FT                   /translation="MPATVAVLGGGYGGMTVAKALDDVADVVLVEPRDAFVHNVAALRG
FT                   VVDREWTDRLFYRYDRLLERGRVVHDRAVRVSGTEIALGSGQTIEADYVVLATGSSYPF
FT                   PAKIDVLDSAAAKDRLHATRDSLERADRVLLLGAGPVGLEFAGEIRAAWPEKAVTIVDP
FT                   AGDVLPAFPVEFRSELRRQLEVLRIELVMGTSLRDQPPSEPGEHKTFTATTGTGAEITA
FT                   DIWFRCFGVEPATGYLAGDLAAARTAGGHVEVTGDLRLPGQERVFAIGDITALPEAKMA
FT                   KSAGDHANVVAANIRTLINGGGEALTTYEPAPPMIALPLGPKGGVSYTADTGVLGPDVT
FT                   SEIKGADLRAGYYAEMLG"
     atgcccgcaa cggtggccgt gctgggtggg ggatacggcg ggatgaccgt cgccaaggcg        60
     ctcgacgacg tcgccgacgt cgtgctcgtg gaaccgaggg acgctttcgt ccacaacgtc       120
     gccgcgctgc gcggtgtcgt cgaccgggaa tggaccgacc ggctcttcta ccgctacgac       180
     cggctgctcg aacgcggccg ggtcgtccac gaccgggcgg tccgcgtgtc cggaaccgag       240
     atcgcgctcg gctccgggca gacgatcgag gccgactacg tcgttctcgc gaccggctcg       300
     tcgtacccgt tcccggcgaa gatcgacgtg ctggacagcg ccgccgcgaa ggacaggctc       360
     cacgccacgc gggactcgct ggagcgtgcg gaccgggtcc tgctgctcgg cgccggaccg       420
     gtcgggctgg agttcgccgg cgagatcagg gcggcatggc cggagaaggc cgtgacgatc       480
     gtggacccgg ccggtgacgt gctgcccgcc ttccccgtgg agttccgcag cgagctgcgc       540
     aggcagctcg aagtgctgcg gatcgaactc gtcatgggca cttccctgcg cgaccagccc       600
     ccgtccgagc ccggggagca caagaccttc accgccacga ccggcaccgg cgcggagatc       660
     accgccgaca tctggttccg ctgcttcggc gtcgaacccg cgaccggcta cctcgcgggc       720
     gacctggcgg ccgcccgcac ggcgggtggc cacgtggagg tcaccggcga cctgcggctg       780
     cccggccagg agcgggtctt cgccatcgga gacatcaccg cgctcccgga agccaagatg       840
     gcgaagtccg ccggcgacca cgccaacgtg gtcgcggcca acatccgcac gctgatcaac       900
     ggcggcggcg aagccctgac cacctacgag cctgcaccgc ccatgatcgc cctgcccctc       960
     ggcccgaagg gcggcgtctc ctacacagcc gacacgggcg tgctcggccc cgacgtcacg      1020
     tcggagatca agggcgcgga cctgagggcg gggtactacg ccgagatgct gggctga         1077
//

If you have problems or comments...

PBIL Back to PBIL home page