(data stored in ACNUC1104 zone)

EMBL: AM420293.PE413

AM420293.PE413       Location/Qualifiers
FT   CDS_pept        complement(472469..473254)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0420"
FT                   /product="hypothetical protein"
FT                   /function="uncharacterized membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99768"
FT                   /db_xref="GOA:A4F6U4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6U4"
FT                   /protein_id="CAL99768.1"
FT                   /translation="METFMPLPATATAEPTGFTGWVIGVMEALGGPGAGLIIALENLFP
FT                   PIPSELILPLAGFTASRGGMTVGGAIFWTTLGSLLGALALYALGAKLGRQRTHAIAAKM
FT                   PLVKLEDVDRTEAWFAKHGVKAVFFGRMIPLFRSFISLPAGVDRMPVSTFALFTTLGSL
FT                   VWNSIFVLAGFYLGENWHLVEQYAGVLSKAVLVAVAAAVVWFVVKRVRQEGRTKHEAEA
FT                   PTEEFAAVGVGADYLEGATSRIPALEPSEAPTVQFRRVR"
     ttggagacgt tcatgcccct gccagccacc gccaccgccg aaccgacggg cttcacgggg        60
     tgggtgatcg gggtcatgga agcgctcggc gggcccggcg cgggcctgat catcgcgctg       120
     gagaacctgt tcccaccgat ccccagcgag ctgatcctgc cgctggccgg gttcaccgcc       180
     agccgcggcg ggatgaccgt cggcggcgcg atcttctgga cgaccctcgg ctccctgctc       240
     ggcgcgctgg ccctctacgc cctcggcgcg aagctcggca ggcagcgcac gcacgccatc       300
     gccgcgaaga tgccgctggt caagctggag gacgtcgacc gcaccgaggc gtggttcgcc       360
     aagcacggcg taaaggcggt gttcttcggc cggatgatcc cgttgttccg cagtttcatc       420
     tcgctgcccg cgggcgtcga ccggatgccg gtgagcacgt tcgcgctgtt caccaccctc       480
     ggcagcctgg tgtggaactc gatcttcgtg ctcgccggtt tctacctggg cgagaactgg       540
     cacctggtcg agcagtacgc gggcgtgctg tcgaaggccg tgctggtcgc ggtggcggcg       600
     gccgtggtgt ggttcgtcgt caagcgcgtg cggcaggagg gccggacgaa gcacgaggcg       660
     gaggccccga cggaggagtt cgcggccgtg ggcgtcggcg ccgactacct ggaaggcgcc       720
     acgtcgcgga tcccggccct ggagccgagc gaggccccga ccgtgcagtt ccgccgcgtc       780
     cgctga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page