(data stored in ACNUC1104 zone)

EMBL: AM420293.PE415

AM420293.PE415       Location/Qualifiers
FT   CDS_pept        476902..477138
FT                   /transl_table=11
FT                   /locus_tag="SACE_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99770"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6U6"
FT                   /protein_id="CAL99770.1"
FT                   /translation="MAAAVVAGAPAFAADAGAAAAAAAQNGNGGDGGNAGNSTNALSCL
FT                   VEVGVANPNSPGGCNPNSNGGAGGAATAAQQED"
     gtggctgccg ctgtggtggc gggggccccg gccttcgccg ccgacgccgg tgccgccgcg        60
     gccgccgcgg cccagaacgg caacggcggt gacggtggca acgcgggcaa ctccacgaac       120
     gcgctgagct gcctggtcga ggtcggcgtc gcgaacccga acagcccggg tggctgcaac       180
     ccgaactcca acggtggtgc gggcggcgcg gcgaccgctg cccagcagga ggactga          237
//

If you have problems or comments...

PBIL Back to PBIL home page