(data stored in ACNUC1104 zone)

EMBL: AM420293.PE420

AM420293.PE420       Location/Qualifiers
FT   CDS_pept        480996..482618
FT                   /transl_table=11
FT                   /locus_tag="SACE_0427"
FT                   /product="integral membrane protein"
FT                   /function="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99775"
FT                   /db_xref="GOA:A4F6V1"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6V1"
FT                   /protein_id="CAL99775.1"
FT                   /translation="MPTTVLTRRLGDTFRLRRGGPVVWPATRAFVSVLAPMAVLLQLHR
FT                   LDLAAGAVFGALTSVYGRSEPYRQQARTLAAVAVTMVLAVAAGDLIAVFGAGHAWHEAL
FT                   ALLGTAVVGAVTTAAATAAKVGAPGGLIFAFATGACAHLALEPADLGPHLAVAAASAAF
FT                   AWAVSTAGAVVSGLGPQRRAVAAALEATAAHLESGGDLATRHRAAVAVETAWNSVALVG
FT                   RRHRETRAHLDLVRAVETCEALLVESGDADVDALRAAATAVGAGRPLPLSGRSAATVVP
FT                   PAPQSRWVLVRGVMRAALRPKRHGSSWLLPYAARVGVAALLAGALADLAGIGHAYWAAV
FT                   SAVSVLQATSTSTSVPRMIQRVLGTVFGVFVGVAVLAAQPGPWVLVAVLAVLQWGAEMT
FT                   VMANYALGLFFATPVALLVSGLATPAEPAELASNRFWATLLGGAIAVGVAWLAPRGPWL
FT                   GRVHRALARVRDLSAETPPRPKALRAALVELHDAYDVAQGEVRDAELPTEELLEVSHRA
FT                   YALADSAPPATGHPTPTPAAPPT"
     gtgccgacca ctgtgctgac tcgacgtctc ggggacacct tccggctgcg caggggcggg        60
     ccggtggtct ggcccgcgac ccgcgccttc gtctcggtgc tcgcgccgat ggccgtgctg       120
     ctccagctcc accgcctcga cctggccgcc ggtgccgttt tcggcgcgct gaccagcgtc       180
     tacggccgta gcgagcccta ccggcagcag gcgcggacgc tcgcggcggt ggccgtcacg       240
     atggtcctcg cggtcgcggc cggcgatctc atcgcggtct tcggcgccgg acacgcctgg       300
     cacgaggcgc tggcgctgct cggcacggcg gtggtcggcg ccgtgaccac cgccgccgcc       360
     accgcggcga aggtcggcgc gcccggcggg ctgatcttcg ccttcgccac cggggcctgc       420
     gcgcacctcg cgctggagcc tgccgacctc ggcccgcacc tcgcggtcgc cgccgccagc       480
     gccgcgttcg cgtgggcggt gagcaccgcg ggtgccgtgg tcagcgggct gggaccgcag       540
     cgccgggccg tcgcggcggc cctggaggcc accgcggcgc acctggagtc gggcggcgac       600
     ctcgcgaccc gccaccgcgc cgcggtcgcc gtcgagaccg cctggaacag cgtcgcgctc       660
     gtcggccgac ggcatcggga gacgcgggca cacctcgacc tggtgcgcgc ggtggagacc       720
     tgcgaggccc tgctcgtgga gtccggcgac gcggatgtgg acgcgttgcg cgccgccgct       780
     accgcagtcg gcgcaggcag gccgctcccg ctctccggac ggtccgccgc gacggtcgtg       840
     ccgcccgcac cgcagtcgcg ctgggtgctg gtccgcggcg tcatgcgcgc cgcgctgcgc       900
     ccgaagcgcc acgggagctc gtggctgctg ccctacgccg ccagggtcgg cgtcgcggcg       960
     ctgctggccg gggcgctggc cgacctggca ggcatcggcc acgcgtactg ggccgccgtg      1020
     tcggcggtgt cggtgctgca ggcgaccagc acgtcgacct cggtgccgcg gatgatccag      1080
     cgcgtccttg gcacggtctt cggcgttttc gtcggagtcg cggtgcttgc ggcgcagccc      1140
     ggcccgtggg tgctggtcgc ggtgctggcg gtgttgcagt ggggtgcgga gatgaccgtc      1200
     atggccaact acgccctggg actgttcttc gcgacgccgg tcgccctgct ggtgagcggg      1260
     ctggccacgc cggcggaacc ggccgagctg gcctccaacc gcttctgggc gacactgctc      1320
     ggcggcgcga tcgccgtggg ggtggcgtgg ctggcgcccc gcggaccctg gctggggcgg      1380
     gtgcaccggg cgctggcgcg ggtccgcgac ctcagcgcgg agaccccgcc gcgcccgaag      1440
     gcgctgcgtg ctgcgctggt cgagctgcac gacgcctacg acgtcgcgca gggcgaggtt      1500
     cgcgacgcgg agctgccgac ggaggagctg ctcgaggtct cgcaccgggc gtacgcgctg      1560
     gcggactccg caccgcctgc gaccgggcat ccgacgccga cgccggcggc accaccgacc      1620
     tga                                                                    1623
//

If you have problems or comments...

PBIL Back to PBIL home page