(data stored in ACNUC1104 zone)

EMBL: AM420293.PE421

AM420293.PE421       Location/Qualifiers
FT   CDS_pept        complement(482689..482988)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0428"
FT                   /product="antibiotic biosynthesis monooxygenase"
FT                   /function="uncharacterized enzyme involved in biosynthesis
FT                   of extracellular polysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99776"
FT                   /db_xref="GOA:A4F6V2"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6V2"
FT                   /protein_id="CAL99776.1"
FT                   /translation="MKINAIEVPEGKGPELEKRFASRHGSVDSAPGFLGFELLRPVNGE
FT                   NRYFVYTRWETEEDFQNWAQGPAKEAHAGEHKNPVATGSSLLEFEVVQESKPQG"
     gtgaagatca atgcgatcga ggtccccgaa ggcaagggcc ccgagctcga gaagcggttc        60
     gcgagcaggc acggctcggt ggacagcgca ccgggcttcc tgggcttcga gctcctgcgc       120
     ccggtcaacg gcgagaaccg gtacttcgtc tacacccggt gggagacgga ggaggacttc       180
     cagaactggg cccagggccc ggccaaggag gcccacgccg gtgagcacaa gaacccggtg       240
     gccaccggat ccagcctgct ggagttcgag gtggtccagg agtccaagcc gcagggctga       300
//

If you have problems or comments...

PBIL Back to PBIL home page