(data stored in ACNUC1104 zone)

EMBL: AM420293.PE423

AM420293.PE423       Location/Qualifiers
FT   CDS_pept        complement(484952..485629)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0430"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /function="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99778"
FT                   /db_xref="GOA:A4F6V4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6V4"
FT                   /protein_id="CAL99778.1"
FT                   /translation="MDIDGADFFARGITALGPEGIVFENVDLRFRPGDLGVVTGPGGSG
FT                   RTALLYALAGRLRTVAGYLEVSGYVLPARARAVRKLVLPARLRPGFELEDKYRVREAVT
FT                   EQRLIFGVSELDVEKSLAAVGLDPDPWALVCELHPAERLLLSIALAVAADPAAIVVDDV
FT                   DVGLPRGSRARVWSALRAVAQTGMTVVAGSTDAPPGDAVVVHLPLFQFGEPTEVLSWNG
FT                   GLR"
     gtggacatcg acggcgccga cttcttcgcc aggggaatca ccgcgctcgg ccccgaggga        60
     atcgtcttcg agaacgtgga cctgcggttc cggcccggcg atctcggcgt ggtcaccggt       120
     cccggcggca gcggccggac cgcactgctt tacgcgctgg cgggcaggct gcggacggtc       180
     gccggatatc tggaggtctc cggctacgtg ctgcccgcgc gggccagggc ggtgcgcaag       240
     ctggtgctgc ccgcgcggtt gcgcccgggt ttcgagctgg aggacaagta ccgcgtccgc       300
     gaggccgtca ccgagcagcg gctgatcttc ggggtgtccg agctcgacgt cgagaagtcc       360
     ctcgcggccg tggggctcga ccccgacccg tgggcgctgg tctgcgagct gcacccggcc       420
     gaacggctgc tgctgtcgat cgcgctggcc gtcgccgccg atcccgccgc gatcgtggtc       480
     gacgacgtcg acgtgggcct gccgcggggc agccgcgcgc gggtgtggtc cgcgctgcgg       540
     gcggtcgccc agaccggcat gacggtggtc gcgggctcga ccgacgcgcc tcccggcgac       600
     gcggtcgtgg tgcacctgcc gctgttccag ttcggcgagc cgaccgaggt cctctcgtgg       660
     aacgggggcc tgcggtga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page