(data stored in ACNUC1104 zone)

EMBL: AM420293.PE424

AM420293.PE424       Location/Qualifiers
FT   CDS_pept        complement(485788..486315)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99779"
FT                   /db_xref="GOA:A4F6V5"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6V5"
FT                   /protein_id="CAL99779.1"
FT                   /translation="MAHALGLFFDDSAEDAVRALWKRLEAAGVPSLASRGHRRHRPHVT
FT                   LAVAGRIPEGARHDLRAELSLLSVPDLWLYTLGTFPSDESVLLLGAVVDTELIAVHSAV
FT                   HDVLAGKVSAPSAYYFPGAWIPHCTLAIGITGAELAKGFTELCPPEPIRAPVSEIGVID
FT                   TRTGDVETVLAL"
     atggcgcacg cgctcgggct gttcttcgac gactccgccg aggacgcggt ccgggcgctg        60
     tggaaacgac tggaggcggc cggggtgccg agcctggcct cccgcggtca ccgcaggcat       120
     cggccgcacg tcacgctcgc cgtcgcgggc cggatccccg agggcgcgcg ccacgacctg       180
     cgcgccgagc tgagcctgct ctcggtgccc gacctgtggc tctacacgct gggcaccttc       240
     cccagcgacg agtcggtgct gctgctcggc gccgtcgtcg acaccgagct gatcgcggtg       300
     cactccgcgg tccacgacgt gctggcgggc aaggtctcgg ccccgtcggc ctactacttc       360
     ccgggcgcgt ggatcccgca ctgcacgctg gccatcggga tcaccggcgc cgagctggcc       420
     aagggcttca ccgagctgtg cccgccggaa ccgatccggg caccggtcag cgagatcggc       480
     gtcatcgaca ctcgcaccgg agacgtcgag accgtgctgg cgctctga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page