(data stored in ACNUC1104 zone)

EMBL: AM420293.PE438

AM420293.PE438       Location/Qualifiers
FT   CDS_pept        complement(497658..498710)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0445"
FT                   /product="conserved hypothetical protein (putative membrane
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99793"
FT                   /db_xref="GOA:A4F6W9"
FT                   /db_xref="InterPro:IPR005552"
FT                   /db_xref="InterPro:IPR018929"
FT                   /db_xref="InterPro:IPR025659"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6W9"
FT                   /protein_id="CAL99793.1"
FT                   /translation="MSAPPPPGWYPDQADPRYVRWWDGRQWTPHAQPAQPQPAAQQQPQ
FT                   PAAQPQPMAQPGPAAQPQQPGPPQPMPPQAPAAQPLAPGQPMPPGTPAPGQPVQQPGRP
FT                   FQQGPHQSPMPQAEDSSSIELALGGTGDSASVQQQVQQRAGVGGHVGGGGGTLFTEPVL
FT                   VVNQKAKLIEMANEYAVYDQTGRQIGSVVQTGQSGAQKALRLLTKLDSLMTVTLEIRDV
FT                   AGQPVLRLTRPATMWKSTVHVQRPDGSPVGDIRMENVWGKVRFAFEAGGQRVGGIHAEN
FT                   LRAWDLRVLDRDEQQVGQISKTWQGLAKAAFTTADNYVLQIFRPLPEPLNSLVVASALT
FT                   VDTVLGQAQR"
     atgagcgctc cgccaccgcc cggctggtac ccggaccagg cagatccgcg atacgtgcgc        60
     tggtgggacg gcaggcagtg gacgccgcac gcgcagcccg cccagccgca acccgccgcg       120
     cagcaacagc cgcagcccgc cgcacagccc cagcccatgg cccagccggg gcccgcagcc       180
     cagccgcagc agccgggccc gccacagccg atgccgccgc aggcaccggc cgcgcagccg       240
     ctcgcgcccg gccagcccat gccgcccggc acccccgcgc cgggccagcc ggtccagcag       300
     ccgggccggc ccttccagca gggaccgcac cagtcaccga tgccgcaggc cgaggactcc       360
     tcgtcgatcg agctggcgct cggcggcacc ggcgactcgg cttccgtcca gcagcaggtg       420
     cagcagcgcg ccggcgtcgg cggccacgtc ggcggtggcg gcgggaccct gttcaccgag       480
     ccggtcctgg tggtcaacca gaaggccaaa ctgatcgaga tggccaacga gtacgccgtc       540
     tacgaccaga ccggccgcca gatcgggtcg gtcgtgcaga ccgggcagag cggtgcgcag       600
     aaggcgttgc ggctgctgac gaagctcgac tcgctgatga cggtcacgct ggagatccgg       660
     gacgtcgccg gacagccggt gctgcggctg acccgcccgg ccacgatgtg gaagtccacc       720
     gtgcacgtcc agcgcccgga cggctcccct gtaggcgaca tccggatgga gaacgtctgg       780
     ggcaaggtcc ggttcgcctt cgaggccggc gggcagcgcg tcggcggcat ccacgccgag       840
     aacctgcgcg cctgggacct gcgcgtgctc gaccgcgacg agcagcaggt cgggcagatc       900
     agcaagacct ggcaggggct ggccaaggcc gcgttcacga cggccgacaa ctacgtcctg       960
     cagatcttcc gtccgctgcc cgagccgctg aacagcctcg tcgtcgcctc cgcgctgact      1020
     gtcgacaccg ttctcggcca ggcgcagcgc tga                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page