(data stored in ACNUC1104 zone)

EMBL: AM420293.PE447

AM420293.PE447       Location/Qualifiers
FT   CDS_pept        complement(506265..507350)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0454"
FT                   /product="sugar ABC transporter, ATP-binding protein"
FT                   /function="ABC-type sugar transport systems, ATPase
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99802"
FT                   /db_xref="GOA:A4F6X8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6X8"
FT                   /protein_id="CAL99802.1"
FT                   /translation="MAEVAYVNASRVYPGSPPVRAVDELGLDVADGEFLVLVGPSGSGK
FT                   STALRMLAGLEDVDEGAITIGGNDVTHTPPKARDIAMVFQSYALYPHMTVAENMGFALK
FT                   LRKTPKQQIREKVTEAAKMLDLEKYLDRKPKALSGGQRQRVAMGRAIVREPSVFLMDEP
FT                   LSNLDAKLRVETRANIAALQKRLGTTTIYVTHDQVEAMTMGHRVAVLKDGLLQQCASPR
FT                   ELYENPANAFVAGFIGSPAMNLKTVPLSGGGAVLDGHTIPVPRGATDGLDEVTFGVRPE
FT                   ALELTSSSEDGLDMTVELVEELGADALVHGTIDVGGSAERFVVRTDGRTPPALGQRVRV
FT                   ALRDAGEVHLFHPETGARLAA"
     atggctgagg ttgcatacgt caacgcgtcg cgggtgtacc ccggtagccc gccggtccga        60
     gcagtcgacg agctcggcct cgacgtcgcc gacggcgagt tcctggtcct ggtagggccg       120
     tccggttcgg gcaagtcgac cgcgttgcgg atgctggccg ggctggagga cgtcgacgag       180
     ggcgcgatca ccatcggcgg caacgacgtc acccacaccc cgccgaaggc gcgcgacatc       240
     gccatggtgt tccagtccta cgcgctgtac ccgcacatga cggtggccga gaacatgggc       300
     ttcgcgctca agctgcgcaa gacccccaag cagcagatcc gcgagaaggt caccgaggcc       360
     gccaagatgc tcgacctcga gaaatacctc gaccgcaagc ccaaggcgct gtcgggcggg       420
     cagcgccagc gggtcgcgat gggccgggcg atcgtgcgcg agcccagcgt gttcctgatg       480
     gacgagccgc tgtccaacct cgacgccaag ctgcgggtgg agacccgcgc caacatcgcc       540
     gcgctgcaga agcggctggg caccacgacc atctacgtca cccacgacca ggtcgaggcc       600
     atgaccatgg gccaccgcgt ggccgtgctc aaggacggcc tgctccagca gtgcgcctcg       660
     ccgcgcgagc tgtacgagaa cccggccaac gccttcgtcg ccggcttcat cggctcgccc       720
     gcgatgaacc tcaagacggt gccgctcagc ggcgggggag ccgttctgga cgggcacacc       780
     atcccggtcc cgcgcggtgc gaccgacggc ctggacgagg tgaccttcgg tgtgcgcccc       840
     gaggcgctgg agctgacctc gtcgtccgag gacggcctgg acatgaccgt cgagctggtc       900
     gaggaactcg gcgcggacgc gctggtgcac ggcacgatcg acgtcggcgg cagcgcggag       960
     cgcttcgtcg tgcgcaccga cggccgcacc ccgcccgcgc tcggccagcg ggtccgggtc      1020
     gcgctgcgcg acgccggcga ggtccacctc ttccaccccg agacgggcgc ccgactcgcc      1080
     gcctga                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page