(data stored in ACNUC1104 zone)

EMBL: AM420293.PE448

AM420293.PE448       Location/Qualifiers
FT   CDS_pept        507537..508637
FT                   /transl_table=11
FT                   /locus_tag="SACE_0455"
FT                   /product="transcriptional regulatory protein (probably
FT                   LacI-family)"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99803"
FT                   /db_xref="GOA:A4F6X9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6X9"
FT                   /protein_id="CAL99803.1"
FT                   /translation="MARSTNARRPATLASLAAELGVSRTTVSNAYNRPDQLSPELRKRV
FT                   LDTARRLGYPGPDPVARSLRTRKAGAVGLLLTENLSYAFRDPGAISFLEGLSLACEDAG
FT                   HGLLLIPASPEREDVASVHRAGVDGFVVYSVPEDDPHLAAVLERPVPVVVCDQPRLDNL
FT                   DWVGPDDARAIKSMADHLIKLGHRRIGVSCMRLARGRNDGLASVQRQANASFHVQKSRL
FT                   TALAESFSEAGVDWTKVPVVERFDHTAASGASAARQLLDLDPDITAIVCTSDILALGAL
FT                   NEARSRGLRVPEDLTVTGFDGIADAERAGLTTVRQPVLEKGRAAGRLLLETSEPGRPRE
FT                   VVLETQLITGTTAAPPRSREERWFGP"
     atggcgcggt caacgaatgc ccggcggcct gcgacgctcg cttcgctcgc ggcggagctg        60
     ggtgtctcca ggactacggt gtcgaatgcg tacaaccgtc ccgaccagct ctccccggag       120
     ctgcgcaagc gggtgctcga cactgcccgg aggctgggct acccgggccc ggacccggtc       180
     gcgcggtcgc tgcggacccg caaggcgggc gcggtcgggc tgctgctgac cgagaacctc       240
     tcctacgcct tccgcgaccc gggcgccatc agcttcctcg agggtctgtc actcgcgtgt       300
     gaggacgcag gccacgggct gctgctgatc ccggcgagcc cggaacgcga ggacgtcgcc       360
     tccgtgcacc gcgcgggcgt ggacggcttc gtcgtgtact cggtgcccga ggacgacccg       420
     cacctggccg cggtgctgga gcgcccggtg ccggtggtgg tctgcgacca gcctcggctc       480
     gacaacctgg actgggtcgg acccgacgac gcccgtgcca tcaagagcat ggccgaccac       540
     ctgatcaagc tcggccaccg ccgcatcggc gtctcctgca tgcgcctggc ccggggccgc       600
     aacgacggcc tggcctcggt gcagcggcag gccaacgcca gcttccacgt gcagaagtcc       660
     cggctcaccg cgctcgccga gagcttcagc gaggcgggcg tggactggac gaaggtcccc       720
     gtcgtggagc gcttcgacca caccgcggcc tccggtgcct cggcggcccg gcagctgctg       780
     gacctcgacc cggacatcac cgcgatcgtg tgcacctccg acatcctcgc gctcggtgcg       840
     ctcaacgagg ccaggagccg agggctgcgg gtgcccgagg acctcaccgt caccggtttc       900
     gacggcatcg ccgacgccga gcgcgcgggc ctgaccaccg tgcgccagcc ggtgctggag       960
     aagggccggg ccgccggacg gctgctgctg gagaccagcg aaccgggcag gccgcgggag      1020
     gtggtgctgg agacccagct catcaccggc acgacggccg cgccgccgcg ttcgcgcgag      1080
     gagcgctggt tcggcccgta a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page