(data stored in ACNUC1104 zone)

EMBL: AM420293.PE450

AM420293.PE450       Location/Qualifiers
FT   CDS_pept        complement(510411..510836)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99805"
FT                   /db_xref="GOA:A4F6Y1"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Y1"
FT                   /protein_id="CAL99805.1"
FT                   /translation="MLQELLSGLLAAVAYGVIGVLMMALGYVLVDLATPGRLRDLIWVQ
FT                   RNPNAALLLVSGLTGVGVILTTAIAASADDLIAGLVGTLAYGLLGLVLMSLSFLLIDAL
FT                   TPGKLGDELASPNMHPGTWVSAVAHVVISVLIAAAIW"
     ttgctccagg aactgctctc cggcctgctc gcggcggtcg cctacggcgt gatcggcgtg        60
     ctgatgatgg cgctcggcta cgtcctggtg gacctggcca cgccgggcag gctgcgcgac       120
     ctgatctggg tccagcgcaa ccccaacgcc gcgctgctgc tggtctccgg cctgaccggc       180
     gtcggggtca tcctgaccac cgcgatcgcc gccagcgccg acgacctgat cgcgggcctg       240
     gtcgggacgc tggcctacgg cctgctcggc ctggtgctga tgagcctgtc gttcctgctc       300
     atcgacgccc tgacgccggg caagctgggc gacgagctgg cgtcgccgaa catgcacccg       360
     ggaacctggg tgtcggcggt cgcgcacgtc gtgatcagcg tgctgatcgc cgccgcgatc       420
     tggtga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page