(data stored in SCRATCH zone)

EMBL: AM420293.PE451

AM420293.PE451       Location/Qualifiers
FT   CDS_pept        complement(510883..511884)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99806"
FT                   /db_xref="GOA:A4F6Y2"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Y2"
FT                   /protein_id="CAL99806.1"
FT                   /translation="MSAGPNQSAGKKKTKAGTWILLAALALLLAIGAISSWAGDDDSPA
FT                   FTDEDTTTYSQSTSYSGPPIRRFTPADSQQLAQQLAVAEKQHGVCFGWKLTDGRDGRFD
FT                   QGSSRGPGVPADTCPRWAEVRTFVANPAGDLGAAGVEVAASPDFDRGALPGTSEYPLVG
FT                   VDAEALVENPVATTGHAALVLPLLLAERGELRAPPVADGEPGARPAKPLPAARSSDGAW
FT                   SIWLWIGGLGLVALVCVLVGVRASGRKKGEQGPPPGGPGPHPPAQGFPQQHAGPHPGGQ
FT                   QPQQQPPAQGFPPQQPGPRPQAPPPHGAPPPHGGPQQPPWPPQAPPPGGPRH"
     atgagcgcgg gcccgaacca gagcgccggg aagaagaaga ccaaggccgg gacctggatc        60
     ctgctggcag cgctggcact gctgctcgcg atcggcgcga tcagctcgtg ggccggggac       120
     gacgactccc ccgcgttcac cgacgaggac acaaccacct acagccagag caccagctat       180
     tccggcccgc cgatccggcg gttcaccccg gccgactcgc agcagctcgc gcagcagctg       240
     gccgtcgcgg agaagcagca cggcgtctgc ttcggctgga agctgaccga cggccgcgac       300
     ggccggttcg accagggttc cagccgcgga ccgggcgtcc cggccgacac ctgcccccgg       360
     tgggcggagg tgcggacgtt cgtggcgaac cccgccggag acctgggcgc ggccggcgtg       420
     gaggtggcgg cgtcgccgga cttcgaccgc ggcgcgctgc ccgggacgtc ggagtacccg       480
     ctcgtcggcg tcgacgccga ggcgctggtg gagaacccgg tggccacgac cggacacgcg       540
     gcgctggtgc tgccgctgct gctggccgaa cgcggggagc tgcgcgcgcc accggtcgcc       600
     gacggcgaac ccggcgcgcg gccggcgaaa ccgctgcccg ccgcgcgaag ctccgacggc       660
     gcgtggtcga tatggctgtg gatcggaggg ctcggcctcg tggcgctggt gtgcgtgctc       720
     gtgggtgtgc gtgccagtgg gcggaagaag ggcgaacagg gcccgccgcc cggtggacca       780
     ggcccgcatc cgccggcaca aggcttcccg cagcagcacg ccggaccgca cccgggcggg       840
     cagcagccgc agcagcaacc gccggcgcag ggattcccac ctcagcagcc aggcccccga       900
     ccgcaggcac cgcccccgca cggcgcaccg cccccgcacg gcggtccgca gcagccgccg       960
     tggccgccgc aggcgccacc gcccggcggt ccgcgccact ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page