(data stored in ACNUC1104 zone)

EMBL: AM420293.PE452

AM420293.PE452       Location/Qualifiers
FT   CDS_pept        complement(511881..512318)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99807"
FT                   /db_xref="InterPro:IPR025341"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Y3"
FT                   /protein_id="CAL99807.1"
FT                   /translation="MKPRLWFLLGGICAVLALVIALVMIFSTGTGPRGYVANHYQRAAH
FT                   LDLRGDDDNRAYTSPLTPSVVSREITSRWQPVAQAADTSGIYLRYKDDAVIVQPRDRGS
FT                   VIHVMDVDHAYHRYHSHVGGTWGWIGTHGESFRGRGPGAGK"
     atgaaacccc ggttatggtt cctgctcggc gggatctgcg cggtgctcgc cctggtcatc        60
     gcgctggtga tgatcttctc cacgggcacc ggcccgcgcg gctacgtggc caaccactac       120
     cagcgcgcgg cgcacctcga cctccgcggt gacgacgaca accgcgccta caccagcccg       180
     ctgaccccga gcgtggtctc gcgggaaatc accagccgct ggcagccggt cgcgcaggcc       240
     gccgacacct ccggcatcta cctgcgctac aaggacgacg cggtgatcgt ccagccgcgc       300
     gaccgcggtt cggtgatcca cgtgatggac gtcgaccacg cctaccaccg ctaccacagc       360
     cacgtcggcg ggacgtgggg ctggatcggt acccacggcg agtcgttccg cggacgcggt       420
     cccggggcgg gcaaatga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page