(data stored in ACNUC1104 zone)

EMBL: AM420293.PE453

AM420293.PE453       Location/Qualifiers
FT   CDS_pept        complement(512315..512944)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99808"
FT                   /db_xref="GOA:A4F6Y4"
FT                   /db_xref="InterPro:IPR025235"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Y4"
FT                   /protein_id="CAL99808.1"
FT                   /translation="MKVVLAIVVVILAIMAVAAVVYLVYTRRGGGDQRAAAPRDPFHTG
FT                   DEDSLRGDPRALKAGDIVEIRGHSYTVRGSLRLSEGGWKWSEHLLDDAKGGQVWLSVEE
FT                   DPDLVLAQWLPAADAGEPGASTIEFGGRTYRSDESGSASFRSEATTGLDEQGTVGYHDY
FT                   EASDGSLLSFERYGDAGWEASTGEQLSRYDVLIYPTAGGTGQEGGR"
     atgaaggttg tgctggcgat cgtcgtcgtg atcctggcga tcatggcggt ggccgccgtc        60
     gtctacctcg tctacacgcg ccgaggcggt ggcgaccagc gggcggccgc cccgcgggac       120
     ccgttccaca ccggcgacga ggactcgctg cgcggtgacc cgcgggcgct gaaggccggc       180
     gacatcgtcg agatccgcgg ccactcctat accgtccgcg gcagcctgcg gctgtccgag       240
     ggcggctgga agtggtcgga gcacctgctc gacgacgcca agggcggcca ggtctggctg       300
     tccgtcgagg aggaccccga cctggtcctc gcccagtggc tgcccgccgc cgacgcgggt       360
     gagccgggcg cgagcacgat cgagttcggc gggcgcacct accgctccga cgagtccggg       420
     tcggcgagct tccgcagcga ggccaccacc gggctggacg agcagggcac cgtcggatac       480
     cacgactacg aggcgtccga cggctcgctg ctgagcttcg agcgctacgg cgacgccggc       540
     tgggaggcca gcaccggcga gcagctgagc cgctacgacg tgctgatcta ccccaccgct       600
     ggcggaaccg gtcaggaagg cggtcgatga                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page