(data stored in SCRATCH zone)

EMBL: AM420293.PE456

AM420293.PE456       Location/Qualifiers
FT   CDS_pept        complement(517594..519045)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0463"
FT                   /product="possible amino acid export carrier protein"
FT                   /function="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99811"
FT                   /db_xref="GOA:A4F6Y7"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Y7"
FT                   /protein_id="CAL99811.1"
FT                   /translation="MGITQRARGVLRRREPAVSAGNRNVVYGPALPDESAVHLVLDLGL
FT                   RIGEIQMSSGAGASDVTATIIAVANAYGLPHCEVDVIYTSITVSCYRGTESLPITSLRV
FT                   VRNRSLDYTRLSETEALVRRITANELSAADAYAELNRISTAPHPFPRWVATLAWAGMAA
FT                   SLAVLLGGGADWRLPLIAAATAALIDRVGRVLNRRALPFFFQQAVGGAVATTIAMGCFA
FT                   TGLLPNPALAVAASIIVLLSGMTVVGSMQDAITGYNVTAAGRITELALMSAGLIAGVVV
FT                   ALYAGLRIFGSDALGGANFDEAMLQNFGRAQVTSPVLLPLVQLAAGASTSACFALASYA
FT                   PPRPLVVAGVGGAVAAFVHAVLTLADVHTVLAGAVATTIVGFIGGIIARRLRIPALVIA
FT                   VSGVAPLLPGLATYRGLYELSVLGSPTGVSTLMLAVAIGLALGSGVVLGEYLAQPVRTR
FT                   LGRLERRFAGPRMSGPLRPTRRRLE"
     gtgggaatca cgcagcgcgc ccgtggtgtg ctgcggcggc gcgaaccggc cgtcagcgcc        60
     gggaatcgca acgtcgtcta cgggccggca ctgcccgacg agtcagccgt acacctggtc       120
     ctggacctgg gcctgcgcat cggcgagatc cagatgtcca gcggcgcggg cgcctcggac       180
     gtgaccgcga cgatcatcgc ggtcgccaac gcctacggtc tgccccactg cgaggtcgac       240
     gtgatctaca cgtcgatcac cgtctcgtgc taccgcggta ccgagtcgct gccgatcacc       300
     tcgctgcgcg tggtccgcaa ccgctcgctc gactacaccc ggctctccga gaccgaggcc       360
     ctggtccgcc ggatcaccgc caacgagctc agcgccgccg acgcctacgc cgagctcaac       420
     cgcatcagca ccgcgccgca cccgttcccg cggtgggtgg cgacgctggc gtgggcgggc       480
     atggccgcct cgctggcggt cctgctcggc ggcggcgccg actggaggct gccgctgatc       540
     gcggccgcga ccgcggcgct gatcgaccgc gtcggccggg tgctgaaccg gcgcgcgctg       600
     ccgttcttct tccagcaagc ggtcggcggc gcggtcgcga ccaccatcgc gatgggctgc       660
     ttcgccaccg gactgctgcc caaccccgct ctcgcggtcg ccgcgtcgat catcgttctg       720
     ctgtccggga tgaccgtcgt cggttcgatg caggacgcca tcaccggata caacgtgacc       780
     gccgcgggac ggatcaccga gctcgcgctg atgtcggcag ggctgatcgc gggcgtggtc       840
     gtcgccctgt acgcggggct gcggatcttc ggctccgacg cgctgggcgg cgcgaacttc       900
     gacgaggcga tgctgcagaa cttcggccgc gcgcaggtga cctcccccgt gctgttgccg       960
     ctggtccagc tcgcggcggg cgcctcgacc tccgcctgct tcgccctcgc cagctacgcg      1020
     ccgccgcggc cgctggtggt ggccggggtc ggcggcgcgg tcgcggcgtt cgtgcacgcc      1080
     gtgctcaccc tcgccgacgt gcacaccgtg ctcgccgggg cggtggcgac cacgatcgtc      1140
     ggtttcatcg gcggcatcat cgcgcgccgg ctgcgcatcc cggcgctggt catcgcggtg      1200
     tcgggcgtgg cgccgctgct gccgggcctg gcgacctacc ggggcctgta cgagctgtcg      1260
     gtgctgggca gcccgaccgg ggtgtcgacg ctgatgctgg cggtcgcgat cgggctggcg      1320
     ctcggctcgg gcgtggtgct gggcgagtac ctcgcgcagc cggtgcgcac ccggctgggc      1380
     cgcctggagc ggcgcttcgc cgggccgcgg atgtccgggc cgctgcggcc cacgcgccgc      1440
     cgcctggagt ga                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page