(data stored in SCRATCH zone)

EMBL: AM420293.PE464

AM420293.PE464       Location/Qualifiers
FT   CDS_pept        complement(525919..526320)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99819"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Z5"
FT                   /protein_id="CAL99819.1"
FT                   /translation="MRLHTERAQGMVGDHHATFIPTHREDNDTPIVMQVSMSVPVSLED
FT                   IEAVFWIAVNGGMLLDERELGNDQYAHEMVLETFLHEGSNRICLAREEIEDIKPGSGDY
FT                   ALLMMIRRRVAELYGRPGVPAPRRALTRA"
     atgcgactgc acaccgagcg ggcacagggc atggtcggcg accaccacgc gacgttcatc        60
     cccacccacc gcgaggacaa cgacaccccg atcgtgatgc aggtgagcat gagcgtgccg       120
     gtgtcgctgg aagacatcga ggccgtgttc tggatcgccg tcaacggcgg gatgttgctg       180
     gacgagcgcg aactcggcaa cgaccagtac gcacacgaga tggtgctgga gaccttcctg       240
     cacgagggct cgaaccgcat ctgcctcgcc cgcgaagaga tcgaggacat caagccgggc       300
     agcggggact acgcgctgct gatgatgatc cgccgccggg tcgccgagct ctacggccgc       360
     cccggggtgc ccgcaccgcg ccgcgcactg acgagggcgt ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page