(data stored in ACNUC1104 zone)

EMBL: AM420293.PE466

AM420293.PE466       Location/Qualifiers
FT   CDS_pept        526899..527141
FT                   /transl_table=11
FT                   /locus_tag="SACE_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99821"
FT                   /db_xref="GOA:A4F6Z7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Z7"
FT                   /protein_id="CAL99821.1"
FT                   /translation="MADEYGVAINTARSALEILRQEGLIAVRHGQGSYVLSQPESGGAD
FT                   AENADVPSVAAVHQQLAEINRRLAAIEERLNELAR"
     ttggctgacg agtacggcgt ggctatcaac accgcccgca gcgcgctgga aatcctgcgg        60
     caggaggggc tgatcgctgt ccgccatggc caggggtcgt acgtcctcag ccagccggag       120
     tccggcggag ccgatgccga gaacgctgac gtgcccagcg tcgcggcggt gcatcaacag       180
     cttgcggaga tcaaccggcg actcgcggcg atcgaggaac gcctgaacga acttgcccgc       240
     tga                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page