(data stored in ACNUC1104 zone)

EMBL: AM420293.PE468

AM420293.PE468       Location/Qualifiers
FT   CDS_pept        527632..528612
FT                   /transl_table=11
FT                   /locus_tag="SACE_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99823"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Z9"
FT                   /protein_id="CAL99823.1"
FT                   /translation="MYTEWEQGRVLPTDWRDELCEVFALPPAALGFVDTAPPPSALDIP
FT                   SALEITRIDAEIVEMLEQQTDHYRLMDRKVGAAIIPQTVAHVEHMEKLLRTALPGKHSH
FT                   LAAVALAEGAALAGWQALDAGDVTKAWNLHDVAKAAARQGEDPAVFAHVTAQQAYALLD
FT                   AGRATEAVELVQYAHTPEIARRVPARLRAWLAAAEAEFLAAAGQHRQALTMLDQAADAL
FT                   PEGDTDPELPFLMLNSTHLARWRGHCLARLGADEAVDDLTRALEGSQVLSSKRAESGLR
FT                   VDLALALRKRGDIEGSKTHAQRAAELAGSTGSARQRARIAKLLVD"
     atgtacacgg agtgggagca gggtcgcgtc cttccgaccg actggcgcga cgaactatgc        60
     gaggtcttcg cgctcccgcc agcggctcta ggcttcgtgg acacggcgcc gccgccgtct       120
     gcattggaca ttccatcggc gctggagatc accaggatcg acgccgagat cgtcgaaatg       180
     ttggagcagc agaccgacca ctaccgtctc atggaccgga aggtcggcgc ggcgatcatc       240
     ccgcagaccg tcgcacatgt tgagcacatg gagaagctgt tacgcactgc cctgcctgga       300
     aagcactccc acctggccgc ggtcgcactt gcggagggcg cagccttggc gggctggcag       360
     gcgctcgatg caggtgacgt cacgaaggcg tggaacctgc acgacgtcgc gaaagctgct       420
     gcccggcaag gtgaagaccc tgctgtgttc gctcacgtga cggctcagca ggcgtacgcg       480
     cttctcgacg ccggccgggc caccgaagca gtcgagctag tccagtacgc acacaccccc       540
     gaaatcgcgc ggcgtgtccc ggctcggctt cgtgcctggc ttgcagctgc ggaggcggag       600
     tttctcgctg ccgctggcca gcaccgccag gcgctcacga tgctcgatca ggcggccgac       660
     gccctacccg aaggcgacac cgatccggaa ctgcctttcc tgatgctgaa cagcacgcac       720
     ctcgcccgtt ggcgtggtca ctgcctcgcc aggctaggcg ctgacgaggc agtcgatgac       780
     cttacgagag ccctggaggg tagtcaggtc ttgtcctcga agcgggcgga gtcgggcctt       840
     cgggtcgatc tcgccttagc gctgcggaag cgtggcgaca tcgaaggttc gaaaacgcat       900
     gcgcagagag ccgcggaact ggcgggcagt acgggatcag cacgacagcg cgcacggatc       960
     gcgaagctgc tcgtggacta g                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page