(data stored in SCRATCH zone)

EMBL: AM420293.PE47

AM420293.PE47        Location/Qualifiers
FT   CDS_pept        complement(67031..67495)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0049"
FT                   /product="FHA domain containing protein"
FT                   /function="FOG: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99402"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5S8"
FT                   /protein_id="CAL99402.1"
FT                   /translation="MPELVIQLTRAGFLALLWLFVLAALRVVRSDLYSASGMRVPMPGS
FT                   GRVQAKQARGKSRAPRQMVVTHGALAGTRISLEGRPIMIGRADDSTLVLDDDYASTRHA
FT                   RLSLRGADWYVEDLGSTNGTYLDRAKVTGPTKVPLGVPIRIGKTVIELRS"
     gtgccagagc tggtgataca gctgaccaga gcagggttcc tcgccctgct ctggttgttc        60
     gtgctggccg cgctgcgcgt ggttcgctcc gatctctact cggcgtccgg catgcgcgtt       120
     ccgatgccgg ggtcgggcag ggtccaggcc aagcaggccc gcggcaagag cagggcaccc       180
     cggcagatgg tggtgaccca cggggctctc gcgggcaccc ggatctcgct ggaaggccgg       240
     ccgatcatga tcggccgggc cgacgactcc acgctggtcc tcgacgacga ctacgcgtcg       300
     acccggcacg ccaggctgtc gctccgcggc gccgactggt acgtggagga tctaggctcc       360
     actaacggca catacctcga tcgggcgaag gtcacggggc cgaccaaggt cccgctcgga       420
     gttccgatca gaatcggcaa gacggtgatc gagctgcgct catga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page