(data stored in SCRATCH zone)

EMBL: AM420293.PE470

AM420293.PE470       Location/Qualifiers
FT   CDS_pept        529484..529735
FT                   /transl_table=11
FT                   /locus_tag="SACE_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99825"
FT                   /db_xref="UniProtKB/TrEMBL:A4F701"
FT                   /protein_id="CAL99825.1"
FT                   /translation="MGSFVGRACSEVLCHLISGNRSAGCHVGESFAEVPYELGVGEHFD
FT                   RFSQPIDLARRHDVGNVLAMRDDGHALATFGTLDGFVP"
     gtgggctcat tcgttggccg cgcgtgctcg gaggtcctct gccatctgat cagcggaaac        60
     cgttcggccg gctgccatgt cggcgagtcc ttcgcggagg tcccgtacga gctcggagtc       120
     ggagagcact tcgatcgttt ctcgcagccg atcgatctcg cccgacggca cgacgtcggc       180
     aacgtgctcg ccatgcgcga tgacgggcac gctctcgcca cgttcggcac gctggacggc       240
     ttcgttccat ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page