(data stored in ACNUC1104 zone)

EMBL: AM420293.PE472

AM420293.PE472       Location/Qualifiers
FT   CDS_pept        531115..531393
FT                   /transl_table=11
FT                   /locus_tag="SACE_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99827"
FT                   /db_xref="GOA:A4F703"
FT                   /db_xref="InterPro:IPR021449"
FT                   /db_xref="UniProtKB/TrEMBL:A4F703"
FT                   /protein_id="CAL99827.1"
FT                   /translation="MRRTRREVALITDAAPSLTEEQRGRKRTYSVLMVLHLAGLTLAAL
FT                   LVDVPWLALGILVLTGPLLWVATVLANSRPPPERRRRAPPPCRALGG"
     atgcggcgca cccggcgcga ggtcgccctg atcaccgacg cggccccgtc gctcaccgag        60
     gagcagcgcg ggcgcaagcg cacgtactcg gtcctgatgg tgctgcacct ggccgggctg       120
     acgctggcag ccctgctcgt ggacgtgccg tggctggcgc tgggaatcct ggtgctgacc       180
     gggccgctgc tctgggtggc gacggtgctg gccaactccc ggccgccgcc ggagcggcgc       240
     cgccgcgcgc cgccaccgtg ccgggctctc gggggctga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page