(data stored in SCRATCH zone)

EMBL: AM420293.PE476

AM420293.PE476       Location/Qualifiers
FT   CDS_pept        532918..533646
FT                   /transl_table=11
FT                   /locus_tag="SACE_0482"
FT                   /product="hydrolase"
FT                   /function="Trypsin-like serine proteases, typically
FT                   ,contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99831"
FT                   /db_xref="GOA:A4F707"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A4F707"
FT                   /protein_id="CAL99831.1"
FT                   /translation="MSIARTLAGAVGAALAMATFAAPAQAAEPTPPPDMRPMIIDGSEV
FT                   DSAPWAARLFVNGQENCSATIIAPEWVLTAQHCVDGAGDGVSFNIGNVDQTQGEKANAK
FT                   PGGVHVHDTADLALVNIDHAVQTEYAPLGSTGDVNVGDTAQTYGWGATCTDKPEIQCQS
FT                   QILKVANVNVTDIACQDYRGGTAVCATRGDGIPAGGDSGGPMFANNVQVGVASTSDRAE
FT                   NTAYTNITEYRDWIKQLAGV"
     gtgtccatcg ctcgtaccct cgccggcgcg gtcggcgccg cgctcgccat ggcgaccttc        60
     gccgcgcccg cccaggccgc cgagccgacg cccccgccgg acatgcgtcc gatgatcatc       120
     gacggctccg aggtggacag cgcgccgtgg gcggcgcggt tgttcgtcaa cggccaggag       180
     aactgctcgg ccaccatcat cgcccccgag tgggtgctga ccgcccagca ctgcgtcgac       240
     ggcgcgggcg acggcgtcag cttcaacatc ggcaacgtcg accagaccca gggcgagaag       300
     gcgaacgcca agccgggcgg cgtgcacgtg cacgacaccg ccgacctggc gctggtcaac       360
     atcgaccacg ccgtgcagac cgagtacgcg ccgctgggct ccaccggcga cgtcaacgtc       420
     ggcgacaccg cccagaccta cggctggggt gcgacctgca ccgacaagcc cgagatccag       480
     tgccagtcgc agatcctgaa ggtcgccaac gtcaacgtga ccgacatcgc ctgccaggac       540
     taccgcggcg gcaccgcggt ctgcgcgacc cgcggcgacg gcatcccggc cggcggtgac       600
     tccggcggcc cgatgttcgc caacaacgtg caggtgggcg tggcctcgac cagcgaccgc       660
     gcggagaaca ccgcctacac caacatcacc gagtaccgcg actggatcaa gcagctcgcc       720
     ggggtctga                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page