(data stored in SCRATCH zone)

EMBL: AM420293.PE485

AM420293.PE485       Location/Qualifiers
FT   CDS_pept        546325..547056
FT                   /transl_table=11
FT                   /locus_tag="SACE_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99840"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:A4F716"
FT                   /protein_id="CAL99840.1"
FT                   /translation="MVETIALPVHAADVLGEQLDLNVRQYPFEIPRLGESPDDRERITN
FT                   QIWAELESAGLARSGRPEPEVEDALYLLSTSEVSIAAAGLLDLRSGQRLAARVVATGEV
FT                   GVVGAIEGRVLRMSFMAPDDLPRACVDLLPDAPPGQGEQVRASADRTNGPPQDADIEGL
FT                   HELEAVTNRQKFRLGHFVVTSTDRRGRRGRLPALNWFDTDRGRYTLVGERAEGHDVITC
FT                   GPADKQRIAAQVHAMLERTRD"
     atggtcgaga cgatcgcact gcccgtccac gcggcggacg tgctcggtga gcagctggac        60
     ctcaacgtcc ggcagtaccc gttcgagatc cccaggctcg gggagtcgcc ggacgacagg       120
     gagcggatca ccaaccagat ctgggccgag ctggagtcgg ccgggctggc gaggtccggg       180
     cggccggagc cggaggtcga ggacgcgctc tacctgcttt cgacgtccga ggtgtcgatc       240
     gcggcagcgg gcctgctcga cctgcgttcc gggcagcggc tcgccgcccg cgtcgtggcg       300
     accggcgagg tcggcgtcgt gggcgcgatc gagggccggg tgctgcggat gagtttcatg       360
     gcccccgacg acctgccccg cgcttgcgtc gacctgctgc cggacgctcc gcctggtcag       420
     ggggagcagg tacgcgcctc ggccgaccgg accaacggcc cgccgcagga cgccgacatc       480
     gaggggctgc acgagctgga ggcggtcacc aaccggcaga agttccgcct cggccacttc       540
     gtggtgacca gcaccgaccg gcgcggccgc cggggcaggc tgcccgccct gaactggttc       600
     gacaccgacc gcggccgcta cacgctggtc ggcgagcgcg ccgaagggca cgacgtgatc       660
     acctgcgggc ctgccgacaa gcagcgcatc gcggcccagg tgcacgccat gctggagcgg       720
     acccgcgact ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page