(data stored in ACNUC1104 zone)

EMBL: AM420293.PE500

AM420293.PE500       Location/Qualifiers
FT   CDS_pept        complement(561869..563854)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99855"
FT                   /db_xref="GOA:A4F731"
FT                   /db_xref="UniProtKB/TrEMBL:A4F731"
FT                   /protein_id="CAL99855.1"
FT                   /translation="MAGSVLKRVRARLATEAGAPDPRQRQYAVLVAVAVVGATALGWIF
FT                   DLHTPGIVAGVTAVFALVATSGQALRSDLHRFVWFTPALALVMTLGPVLSNVPVLAGIA
FT                   VASVVFGAGMLPAMGEHYRVGGQTLAAATLFSTTTGIGSDQSVLVLLASSVAGVAFALL
FT                   LRVLVGLGDPTRATRIAVAGTLLEPGPGVVELAASAWRADGASTWLGQVLAGAARFRAA
FT                   RETLLAQAQQVGRLEAERLREIVAEADRVAAQLAIAVRSRACSGLPASARLDPAEVVLR
FT                   RGGRQDLPDAARGLNQGLDRIRAAVVERDETPATPPAPGGRRERAMGAVRAHLSMRSSL
FT                   FRHALRCTLAVGVGMVIVLLLNDPSESGLLLALYVVLQPAARDSMNGALERTGGAVLGV
FT                   VALAALITLLPGAYLLVPLVVAAMLVNIDRLRTDYRTLLGALIVITVVDQAMQLDRPLV
FT                   NVAISFAANSAIGAAIALSVGYVSYLVLPSSALPDVRGAIRSTVWSVSELLRSVRAAGQ
FT                   GANLRQALHSAHVLAMRRTQDLLGMPALLDGNDEETEDERVTRDAAVALDALRQDVATL
FT                   AFRPETERAIAVPALRAVDDLLAGKTSAKIPDVAENTAPATELLASSLVENALHARAAI
FT                   DRTFGYDSPWKSYTISFVRPERLHIK"
     gtggctggtt cggtgttgaa acgggtgcgg gctcgactgg ccaccgaggc gggtgcgccg        60
     gatcccagac agcgccagta cgccgtgctg gtcgcggtcg cggtggtggg cgcgacggcg       120
     ctcggctgga tcttcgacct gcacaccccc gggatcgtcg ccggggtgac ggcggtgttc       180
     gcgttggtcg ccacgagcgg ccaggcgctg cgctcggacc tgcaccgctt cgtctggttc       240
     acgcccgcgc tggcgctggt gatgacgctg gggccggtgc tctccaacgt cccggtgctg       300
     gccggtatag cggtggcgag cgtggtgttc ggcgccggga tgctgcccgc gatgggcgag       360
     cactaccgcg tcggcggcca gacgctggcc gccgcgacgc tgttctcgac caccaccggc       420
     atcggcagcg accagtcggt gctggtgctg ctggcgtcct cggtcgccgg tgtggctttc       480
     gcgctgctgc tcagggttct cgtcggactc ggcgacccga cccgtgccac ccgcatcgcc       540
     gtcgcgggca cgctgctcga gcccggcccc ggagtcgtgg agctggccgc gagcgcatgg       600
     cgcgccgacg gcgcgagcac ctggctcggt caggtgctcg ccggcgcggc ccggttccgg       660
     gcggcgcggg agacgctgct cgcgcaggcc cagcaggtcg ggcggctgga agccgagcgg       720
     ctgcgggaga tcgtcgccga ggccgaccgg gtcgccgcgc agctcgcgat cgccgtccgg       780
     tccagggcgt gcagcgggct gcccgcgtcg gcgcggctcg acccggccga ggtggtcctg       840
     cggcgcggcg gcaggcagga cctgccggac gcggcgcgcg ggctcaacca gggtctggac       900
     cgcatccgcg cggcggtggt cgagcgcgac gagacgcccg cgacgccgcc cgcgccgggc       960
     gggcgccgcg agcgcgcgat gggcgcggtc cgcgcgcacc tgtcgatgcg gtcctcgctg      1020
     ttccgccacg cgctgcgctg cacgctcgcg gtcggcgtcg gcatggtgat cgtgctgctg      1080
     ctcaacgacc cgtcggagtc aggtctgctg ctggcgctgt acgtggtgct gcaaccggcg      1140
     gcccgcgaca gcatgaacgg cgcgctggag cgcaccggcg gcgcggtgct cggcgtggtc      1200
     gcgctggccg cgctgatcac cctgcttccc ggcgcctacc tgctggtccc gctggtggtc      1260
     gcggcgatgc tggtcaacat cgaccggctg cgcacggact accggacgct gctcggcgcg      1320
     ctcatcgtga tcaccgtcgt cgaccaggcg atgcagctgg accggccgct ggtcaacgtg      1380
     gcgatcagct tcgcggccaa cagcgccatc ggcgcggcca tcgcgctcag cgtcggctac      1440
     gtcagctacc tggtgctgcc cagcagtgcg ctgccggacg tgcgcggcgc gatccgctcc      1500
     accgtgtggt cggtgtcgga gctgctgcgc agcgtgcgtg ccgccgggca gggcgccaac      1560
     ctgcggcagg cgctgcactc ggcgcacgtg cttgccatgc ggcgcaccca ggacctgctc      1620
     ggcatgccgg cgctgctcga cggcaacgac gaggagaccg aggacgagcg ggtcacccgc      1680
     gacgcggcgg tcgccctgga cgcgttgcgc caggacgtcg ctacgctggc gttccgcccc      1740
     gagaccgagc gggccatcgc ggtgcccgcg ctgcgcgcgg tcgacgacct gctcgccggg      1800
     aagacctcgg cgaagatccc cgacgtcgcc gagaacaccg ctcccgcgac ggagctgctg      1860
     gccagctccc tggtggagaa cgcgctgcac gcccgcgcgg cgatcgaccg caccttcggc      1920
     tacgacagcc cgtggaagag ctacacgatc tcgttcgtcc gcccggagcg cctgcacatc      1980
     aagtga                                                                 1986
//

If you have problems or comments...

PBIL Back to PBIL home page