(data stored in ACNUC1104 zone)

EMBL: AM420293.PE504

AM420293.PE504       Location/Qualifiers
FT   CDS_pept        567567..568151
FT                   /transl_table=11
FT                   /locus_tag="SACE_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99859"
FT                   /db_xref="GOA:A4F735"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A4F735"
FT                   /protein_id="CAL99859.1"
FT                   /translation="MVYTPSGQQAPPLWANWEYLVGAWQGLNIPEGWRLELIEERLVPV
FT                   SPPEYRHGQIVDVLHRDFAARSPRDAAVFRTVSVVIPSRRSLFIPDLLVAAESRAASDA
FT                   VSVEAEKTLLVAEISGKAESAGDRELKLWSYAHAGAPLYLVVDPWAKGGSVVRLYSEPH
FT                   NAAYLRCAEVRFGEVIEVPEPFGFSLDTAEF"
     atggtgtaca ccccaagtgg tcagcaggcg ccgccgctgt gggcgaactg ggagtacctc        60
     gtcggggcct ggcagggcct caacatcccg gagggctggc ggctggaact gatcgaggag       120
     cggctggtcc cggtttcccc gcccgagtac cggcacggcc agatcgtcga tgtcctccac       180
     cgcgacttcg cggcgcgaag tccgcgcgac gccgccgttt tccggaccgt cagcgttgtc       240
     atcccgtcca ggcgcagcct tttcatcccg gacctgctgg tggctgcgga atcgcgggcc       300
     gcgtcggacg cggtgtcggt cgaggcggag aaaacccttc tggtggccga gatatccggc       360
     aaggccgagt cggccgggga ccgcgagctc aagctgtgga gctacgccca cgccggggct       420
     ccgctgtacc tggtcgtcga tccgtgggcg aagggcgggt cggtggtgcg gctgtactcc       480
     gaaccgcaca acgccgccta cctccggtgc gccgaggtcc gcttcggcga ggtgatcgag       540
     gtgccggagc cgttcgggtt ctccctcgac accgccgagt tctga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page