(data stored in ACNUC1104 zone)

EMBL: AM420293.PE508

AM420293.PE508       Location/Qualifiers
FT   CDS_pept        570089..570346
FT                   /transl_table=11
FT                   /locus_tag="SACE_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99863"
FT                   /db_xref="UniProtKB/TrEMBL:A4F739"
FT                   /protein_id="CAL99863.1"
FT                   /translation="MAAQRWVREVLLGEHSFVFLVELADAGEADRFRDACAANQWTTRV
FT                   VEDAERRLPLAPADQAEVYRKLQLATRVWGRSFAPHQRPR"
     atggctgcgc agcggtgggt gcgggaagta ctgctcggcg agcattcctt cgtcttcctc        60
     gtcgagctgg ccgacgcggg cgaggccgac cgattccgcg atgcgtgcgc ggccaaccag       120
     tggaccaccc gcgtcgtgga ggacgctgaa cggcggctgc cgctggcgcc tgccgaccag       180
     gccgaggtct accgcaagtt acagctcgcc acccgggtct ggggccgctc attcgctccg       240
     caccaacgcc cgaggtga                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page