(data stored in ACNUC1104 zone)

EMBL: AM420293.PE509

AM420293.PE509       Location/Qualifiers
FT   CDS_pept        570420..570905
FT                   /transl_table=11
FT                   /locus_tag="SACE_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99864"
FT                   /db_xref="GOA:A4F740"
FT                   /db_xref="UniProtKB/TrEMBL:A4F740"
FT                   /protein_id="CAL99864.1"
FT                   /translation="MAAVPSVAGRIAGAVAERAEDRLARSLWRSHLVLEGAGFAALYVG
FT                   RGGQVGVRRGTWLVERLSGFWGVSLLALVPLCGLFGRIAVRSIGRERLRRALGWGVPLL
FT                   LTAILPVFGDWLLDTYLSPFALDSTDVKAGLTDSVHRVDTPTAAMRCGTRWPSGRAA"
     ttggccgccg tcccgtcggt ggcgggccgg atcgccggcg cggtagccga gcgggccgag        60
     gaccggctcg cccgctcgtt gtggcgctcg cacctggtgc tggaaggtgc gggcttcgcg       120
     gcgctctacg tcggtcgtgg cgggcaggtc ggtgttcgtc ggggcacgtg gctggtggag       180
     aggctgtccg gcttctgggg ggtgtccctg ctagcgctgg tgccgctgtg cggcctcttc       240
     ggcaggatcg cggtccgctc catcggccgg gagcggctgc gccgtgcgct cggttggggc       300
     gtgccgctgc tgctgaccgc gatcctgccg gtgttcggtg actggctact ggacacctac       360
     ctgtcgccgt tcgcactgga ctcgaccgac gtcaaggccg ggctgaccga ctcggtgcac       420
     cgggttgaca cgccgacggc cgctatgcgc tgtgggaccc ggtggccgag cggtcgagcc       480
     gcgtga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page