(data stored in ACNUC1104 zone)

EMBL: AM420293.PE510

AM420293.PE510       Location/Qualifiers
FT   CDS_pept        complement(571045..573282)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0519"
FT                   /product="cell division control protein 48 (cdc48), AAA
FT                   family"
FT                   /function="ATPases of the AAA+ class"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99865"
FT                   /db_xref="GOA:A4F741"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A4F741"
FT                   /protein_id="CAL99865.1"
FT                   /translation="MPSLTLTARLSPSALDTRRGVVRLHPEVLDALGLRPWSAVELTGS
FT                   RVTVALAAAAPPGGPTGVVLLDDVALTNLGLSEGAEVGVSPAEVRTAHRLRIAGSRMAT
FT                   ATVSADTVRMALTGKVFRTGDTVSLLPQDVAPAPGSDAGEVRRKLSAAIGMTWTNELIT
FT                   ITATDPDGVVAVKPSTVVEWRADAFAPAATDDGVAPQPAAVQPAPEAPAAPAESAVAVS
FT                   DLAGAKDSANRLDEWLRLSFEQPELLRRLGATPHLGVLVSGPSGVGKATMARAVAASVG
FT                   ARTVEVGAPSIAALEARTAAQRFQDALGRASTAAAGDGGCVLLITDVEDLLPASDPPPL
FT                   ATVVLDALKGAIATERLAVVVTSAHPQSVDPRLREPGLVDRELTIGLPDAATRTDLLRV
FT                   LLRNAPLEADVRLAEVAERAPGFVAADLVALCRESAVVAALRHRGEPGAEDARIRQQDL
FT                   LDALSSVRPISMSTSDDLQTGGLTLDEVGDMAEVKQSLTEAVLWPLQYPDSFTRLGVQP
FT                   PRGVLLYGPPGCGKTFLVRALAGSGRLNVLSVKGAELMDKFVGESERAVRELFLRAANA
FT                   APALVFLDEVDALAPRRGQSSDSGVGDRVVAALLTELDGVEPMRDVVVLGATNRPELVD
FT                   PALLRPGRLERLVYVPPPDADAREAILRSAAKNTPLSSDVDLGALAGSLEGYSAADCAA
FT                   LVREAALTAMRESLAAAEVSAAHLDVARTAVRPSLDPAQLASLETYADSRR"
     gtgccctcgc tcacgctcac cgcacgcctg tcgccgtcgg ccctggacac ccggcgcggg        60
     gtcgtccgcc tccaccccga agtgctcgac gcgctgggtc tgcgcccgtg gagcgcggtg       120
     gagctgaccg gcagccgggt caccgtcgcg ctcgccgcgg cggctccgcc cggcgggccg       180
     accggcgtgg tgctgctcga cgacgtcgcg ctgaccaacc tcggcctctc cgagggcgcc       240
     gaggtcgggg tctcgcccgc cgaggtccgc accgcgcacc gcctccgcat cgcgggctcg       300
     cggatggcga ccgccacggt ctcggccgac accgtgcgca tggctctgac cggcaaggtc       360
     ttccgcaccg gcgacaccgt gtcactgctg ccgcaggacg tggcacccgc gcccggctcc       420
     gacgcgggcg aggtgcggcg caagctctcc gcggcgatcg gcatgacctg gaccaacgag       480
     ctgatcacca tcaccgccac cgaccctgac ggcgtcgtcg cggtgaaacc gtccacagtg       540
     gtcgaatggc gggcggacgc cttcgccccg gccgcgacgg acgacggcgt cgcgccgcag       600
     ccggccgccg tacagcccgc gccggaagcc ccagccgcgc cggccgagag cgctgtcgcg       660
     gtgtccgacc tggccggcgc caaggacagc gccaaccgcc tcgacgaatg gctgcggctg       720
     tcgttcgaac agcccgagct gctgcgccgc ctcggcgcca ccccgcacct cggcgtgctg       780
     gtcagcggcc cctccggagt cggcaaggcg acgatggccc gcgcggtcgc ggcgtcggtc       840
     ggtgcccgga cggtcgaggt cggcgcgccc agcatcgccg cgctcgaggc ccgcaccgcc       900
     gctcagcggt tccaggacgc gctgggccgg gcgagcaccg cggcggccgg agacggcggg       960
     tgcgtgctgc tcatcaccga cgtcgaggat ctgctgcccg cgtccgaccc acccccgctg      1020
     gccacggtcg tgctcgacgc gctgaagggc gcgatcgcca ccgaacgcct cgccgtcgtg      1080
     gtcaccagcg cgcacccgca gtcggtggac ccgcgcctgc gcgaaccggg actggtcgac      1140
     cgcgagctga ccatcggcct gcccgacgcg gccacgcgga ccgacctgct gcgggtgctg      1200
     ctgcgcaacg cgccgctgga ggccgacgtg cggctcgccg aggtcgccga gcgggcgccc      1260
     ggcttcgtcg ccgcggacct ggtcgcgctg tgccgggagt cggcggtggt ggcggcgctg      1320
     cgccaccggg gcgagccggg agccgaggac gcccgcatcc gccagcagga cctgctcgac      1380
     gcgctgtcgt cggtccgccc gatctcgatg tccacttcgg acgacctcca gaccggcggc      1440
     ctgacgctgg acgaggtggg cgacatggcc gaggtcaagc agtcgttgac cgaggcggtg      1500
     ctgtggccgt tgcagtaccc ggactccttc acccggctgg gggtccagcc gccgcgcggt      1560
     gtgctgctct acggcccgcc gggctgtggg aagacgttcc tcgtgcgtgc cctggcgggc      1620
     agcggccggc tcaacgtgct gtcggtcaag ggcgcggagc tgatggacaa gttcgtcggc      1680
     gagtccgagc gggcggtgcg ggagctgttc ctgcgcgccg cgaacgccgc tcccgcgctg      1740
     gtcttcctcg acgaggtgga cgcgctggcc ccgcgtcgcg ggcagtcgtc ggactccggc      1800
     gtcggcgacc gcgtggtggc ggcgctgctc accgagctcg acggcgtcga gccgatgcgc      1860
     gacgtcgtgg tcctgggcgc gacgaaccgc cccgagctgg tcgacccggc gctgctgcgg      1920
     cccggaaggc tggagcggct ggtgtacgtg ccgccgccgg acgccgacgc gcgcgaggcg      1980
     atcctgcgct cggcggcgaa gaacactccg ctgtcgtccg atgtggacct cggcgcgctg      2040
     gcggggtcgc tggagggcta ctcggcggcg gactgcgcgg cactggtccg ggaggcggcc      2100
     ctcaccgcga tgcgggagtc cctcgccgcc gcggaggtct ccgccgcaca cctggacgtc      2160
     gctcgcaccg cggttcggcc gtcgctcgac cccgcgcagc tcgcctccct ggagacctac      2220
     gccgactcca ggcgctga                                                    2238
//

If you have problems or comments...

PBIL Back to PBIL home page