(data stored in SCRATCH zone)

EMBL: AM420293.PE513

AM420293.PE513       Location/Qualifiers
FT   CDS_pept        complement(576336..578306)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99868"
FT                   /db_xref="GOA:A4F744"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A4F744"
FT                   /protein_id="CAL99868.1"
FT                   /translation="MRGPWRAAFALALHIGFFALPIGLVAGLLAIAVFTFGYDRGSGLR
FT                   VALVALVVGAVLGVGMRAVLRSRNRPRGVALSRSEHPQLWKAVDAICSAAHTAAPDEIR
FT                   VTSEPNAFVREDTALLGLRTRARYLEVGLPLLAGLTASELRAVLAHEIGHLAARGRLTA
FT                   MAYRASTSVERAASDLTGGPTKWLFGGYARLYSAAAGSTSPDLELAADAVAVRVTGKRA
FT                   AVTALRKATAIEFGWREYAESYLSMAVSVERTPDVLLGFRAFMENSVRKPKLAERAKQA
FT                   IAAESAGDSGHPTTRERIAAMKRMSGADKELDDRPAFALLRNPRKSVPVLEDRLLVDGL
FT                   GPRMPWPELARLAGAEHVAHQASLLSSAVAQSGITTDPAIGGVLQAVHRGEGPDLVNPV
FT                   LNPGLAPDRIAEAAVDTLTELLGGAVVDALVSAGRAHHELDWAGPSVVRLTNGRPLDPD
FT                   RLVRPAVADPRLVPGLHRALVDLGVPLNHSRPPAEEPEASVAGLVSPVELAGSRYDMVV
FT                   TDRGLVLLPTTASTAQRLLAGAVARAGRAERKQLAELAATPVAELRERRDAQWVDSRDV
FT                   ASARLLQERRGWTLVLDLYLDEYAVSSLDEGSVAPDADGAASAELRSTPDSMEHGDPYS
FT                   GLGELMGARMDIDDQRDLTEE"
     ttgcgtggcc cctggcgcgc cgcattcgcg ttggcgctgc acatcggctt tttcgccctt        60
     ccgatcgggc tcgtcgccgg cctgctcgcg atcgcggtgt tcacgttcgg atacgaccgg       120
     ggcagcggcc tgcgcgtcgc gctggtcgca ctggtcgtcg gcgccgtgct gggcgtcggc       180
     atgcgcgccg tgctgcgttc ccgcaaccgc ccgcgcggcg tcgcgctgag ccggtccgaa       240
     cacccccagc tgtggaaggc ggtcgacgcg atctgctcgg ccgcccacac cgcggcaccc       300
     gacgagatcc gcgtcacctc cgaacccaac gccttcgtcc gggaggacac cgcgctgctg       360
     ggcctgcgca cccgcgcccg ctacctggag gtcgggctgc cgctgctggc cgggctgacg       420
     gccagcgagc tgcgcgcggt gctggcccac gagatcggcc acctcgcggc gcgcggcagg       480
     ctgaccgcga tggcctaccg ggcgtcgacg agcgtggagc gggccgcctc cgacctgacc       540
     ggcggaccga cgaagtggct cttcggcggc tacgcccgcc tctacagcgc cgccgcgggc       600
     agcaccagcc cggacctgga gctggcggcc gacgcggtcg cggtgcgggt caccggcaag       660
     cgcgcggcgg tgaccgccct gcgcaaggcc accgccatcg agttcggctg gcgcgagtac       720
     gccgagagct acctcagcat ggcggtgagc gtggagcgca cgcccgacgt gctgctgggc       780
     ttccgggcgt tcatggagaa cagcgtccgc aagcccaagc tcgccgaacg cgccaagcag       840
     gcgatcgccg ccgagtccgc cggggacagc gggcacccga ccacccgcga gcgcatcgcc       900
     gcgatgaagc ggatgagtgg cgccgacaag gagctcgacg accgcccggc gttcgcgctg       960
     ctgcgcaacc cccgcaagag cgtgcccgtg ctggaggacc ggctcctggt cgacgggctc      1020
     ggcccgcgca tgccgtggcc ggagctggcg cggctggcag gcgccgagca cgtcgcgcac      1080
     caggcgtcgc tgctcagctc ggcggtcgcg cagagcggga tcacgaccga cccggccatc      1140
     ggcggcgtcc tgcaggcggt gcaccgcggc gaggggccgg acctggtgaa cccggtgctc      1200
     aaccccggtc tcgcccccga ccgcatagcc gaggcggcgg tcgacacgct caccgagctg      1260
     ctcggcggcg cggtggtcga cgcgctggtg tcggcggggc gggcgcacca cgagctggac      1320
     tgggccgggc cgtcggtggt ccggctgacc aacgggcgcc cgctcgaccc ggaccggctg      1380
     gtccgcccgg ccgtggccga tccccggctg gtgccggggc tgcaccgcgc gctggtcgac      1440
     ctcggggtcc cgctgaacca ctccaggccc ccggccgagg aacccgaggc gtcggtcgcg      1500
     ggcctcgtca gccctgtcga gctggccggg tcgcgctacg acatggtcgt caccgaccgc      1560
     gggctggtgc tcctgcccac cacggccagc accgcgcagc ggctgctggc gggcgcggtc      1620
     gcccgcgcgg gccgggcgga gcggaagcag ctcgcggagc tggcggcgac gccggtggcg      1680
     gagctgcgcg agcgacggga cgcgcagtgg gtcgacagcc gcgacgtcgc gtcggcccgg      1740
     ctgctccagg aacgccgggg ctggaccctc gtcctggatc tatacctcga cgaatacgcg      1800
     gtgtcatcac tcgacgaggg gtcggttgct ccggatgccg acggcgcggc gtcggccgag      1860
     ctgcgcagca cccctgattc catggagcac ggcgacccct acagcggcct gggagagctg      1920
     atgggcgcga ggatggacat cgacgaccaa cgcgatctca cggaggagtg a               1971
//

If you have problems or comments...

PBIL Back to PBIL home page