(data stored in ACNUC1104 zone)

EMBL: AM420293.PE523

AM420293.PE523       Location/Qualifiers
FT   CDS_pept        589507..589893
FT                   /transl_table=11
FT                   /locus_tag="SACE_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99878"
FT                   /db_xref="UniProtKB/TrEMBL:A4F754"
FT                   /protein_id="CAL99878.1"
FT                   /translation="MFEVLESGPPREVAVAAARHVVEWSRRNTAQARVLLAGSAAFGES
FT                   EWTPQARDELRRLNEEMFAAMAEVARGTGTCGELGYGRFSLAVVDLPIAVVRRNLTRGD
FT                   EIPEHEVAVVVEAVRDLLADGQGR"
     ttgttcgagg tgctcgagtc gggtcccccg agggaggtgg cggtcgccgc cgcgcgccac        60
     gtggtcgagt ggtcgcgtcg caacacggcg caggcgcggg tgctgctcgc gggctccgcg       120
     gctttcggcg agtcggagtg gacccctcag gccagggacg agctgcgccg cctcaacgag       180
     gagatgttcg ccgcgatggc cgaggtcgcg cggggcacgg ggacctgcgg cgagctgggc       240
     tacggccggt tctcgctggc cgtggtggac ctgccgatcg cggtcgtccg gcgcaacctc       300
     acgcggggtg acgagatccc cgagcacgag gtcgccgtcg tggtcgaggc cgtgcgggac       360
     ctgctggccg acggccaggg gcgctga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page