(data stored in SCRATCH zone)

EMBL: AM420293.PE525

AM420293.PE525       Location/Qualifiers
FT   CDS_pept        590852..591946
FT                   /transl_table=11
FT                   /locus_tag="SACE_0534"
FT                   /product="VWA containing CoxE-like protein"
FT                   /function="Protein containing von Willebrand factor type A
FT                   (vWA) domain"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99880"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A4F756"
FT                   /protein_id="CAL99880.1"
FT                   /translation="MDRTVIGLVGFARALRHSGMACGPSRVQAFLDAAEEVGLDDRDSL
FT                   YWAGRLTLCSDPDDIPRYDTAFGCWFGHDPMPSPQGGHAVPRPARIAALTAASGESDEG
FT                   AEPLSAAASEAEVLRRRDFAELGAAEREHLRRLLAVLRPDPPQRPALRRAPSRRGGLDA
FT                   RATLRELLRTAGEPLRLPRRSRARRPRRVVLLIDVSGSMAPYADSLLRFAHVVVRRSPA
FT                   STEVFTLGTRMTRVSRQLRQRDPEQALDAAARAVPDFSGGTRLGETLRAFLDRWGQRGV
FT                   ARGAVVVLFSDGWERGDVSVLAEQMRRLRRLTRSVIWANPHAGHEGYEPVQSGILAAMP
FT                   HVDGMVAGHSLRALEEIWARVLDR"
     atggaccgca cggtgatcgg gctggtgggg ttcgcccgcg cgctgcggca ttccggcatg        60
     gcctgcggtc cctcccgggt gcaggcgttc ctcgacgccg ccgaggaggt cggcctggac       120
     gaccgggact cgctgtactg ggccggacgg ctcacgctgt gctccgaccc cgacgacatc       180
     ccgcgctacg acaccgcgtt cggctgctgg ttcggccacg acccgatgcc ctcgccgcag       240
     ggcggccacg ccgtaccccg cccggcgcgg atcgcggcgc tgaccgcggc ctccggcgag       300
     agcgacgagg gcgccgagcc gctgtcggcc gcggccagcg aggccgaggt gctgcgcagg       360
     cgcgacttcg ccgagctggg cgccgccgag cgggagcacc tgcgcaggct gctcgcggtg       420
     ctgcgccccg atccgccgca gcggcccgcg ctgcgccggg cgccgtcgag gcgcggcggg       480
     ctggacgccc gcgccacgct gcgggagctg ctgcgcacgg ccggggagcc gttgcggctg       540
     cctcggcgga gccgggcacg caggccgcgg cgggtggtgc tgctgatcga cgtgtccggg       600
     tcgatggcgc cctacgccga ctcgctgctg cgcttcgccc acgtcgtcgt ccgccgctcg       660
     cccgccagca cggaggtctt cacgctgggc acccgcatga cgcgggtcag caggcagttg       720
     cggcagcgcg acccggagca ggcgctggac gccgccgccc gcgcggtgcc ggacttctcc       780
     ggcggcaccc ggctcgggga gacgctgcgg gcgttcctgg accgctgggg gcagcgcggg       840
     gtggcgcgcg gcgcggtcgt ggtgctgttc tccgacggct gggagcgcgg tgacgtgtcg       900
     gtgctggccg agcagatgcg caggctgcgc cggctcaccc ggtcggtcat ctgggccaac       960
     ccgcacgccg ggcacgaagg ctacgaaccg gtgcagtccg gaattctcgc cgccatgccg      1020
     cacgttgatg ggatggtcgc cggtcacagc ctgcgcgcgt tggaggagat ctgggcgcgg      1080
     gtactcgacc gctga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page