(data stored in ACNUC1104 zone)

EMBL: AM420293.PE527

AM420293.PE527       Location/Qualifiers
FT   CDS_pept        593252..593812
FT                   /transl_table=11
FT                   /locus_tag="SACE_0536"
FT                   /product="carbon monoxide dehydrogenase small chain"
FT                   /function="Aerobic-type carbon monoxide dehydrogenase,small
FT                   subunit CoxS/CutS homologs"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99882"
FT                   /db_xref="GOA:A4F758"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A4F758"
FT                   /protein_id="CAL99882.1"
FT                   /translation="MPRITVNVDGTRYTDDVEPRTLLVHHLRERLGKVGTVVGCDTSNC
FT                   GACTVHLDGQSVKSCSVLAVQADGCEVTTIEGLARDGELHPLQQAFHDNHALQCGFCTP
FT                   GMIMQALDLLAENPDPDTDEVREGLEGNLCRCTGYQNIVKAVRDAAQKMRPGAGPPIEH
FT                   TEDTPMQRTGQEQDTKVTGGRQS"
     atgccgcgca tcaccgtcaa cgtggacggc acccgttaca ccgacgacgt agagcctcga        60
     acactcctcg tccaccacct acgcgagcga ctcggaaagg tcggcacggt cgtcggttgc       120
     gacaccagca actgcggggc gtgcaccgtc cacctcgacg gccagagcgt gaagtcctgc       180
     tcagtgctcg ccgtgcaggc cgatggctgc gaggtgacca ccatcgaggg gctggcccgc       240
     gacggcgagc tgcaccccct ccagcaggcg ttccacgaca accacgcgct ccagtgcggg       300
     ttctgcacgc ccggcatgat catgcaggcg ctggacctgc tcgccgagaa ccccgacccg       360
     gacaccgacg aggtccgcga gggcctggaa ggcaacctct gccgctgcac cggctaccag       420
     aacatcgtca aggcggtgcg ggacgcggcg cagaagatgc ggccaggtgc cggacccccg       480
     atcgagcaca ccgaggacac cccgatgcag cgcaccgggc aggagcagga cacgaaggtg       540
     acgggaggtc gccagtcatg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page