(data stored in ACNUC1104 zone)

EMBL: AM420293.PE529

AM420293.PE529       Location/Qualifiers
FT   CDS_pept        596244..597098
FT                   /transl_table=11
FT                   /locus_tag="SACE_0538"
FT                   /product="carbon monoxide dehydrogenase medium subunit"
FT                   /function="Aerobic-type carbon monoxide
FT                   dehydrogenase,middle subunit CoxM/CutM homologs"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99884"
FT                   /db_xref="GOA:A4F760"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A4F760"
FT                   /protein_id="CAL99884.1"
FT                   /translation="MIPASFDYIAPSTVEEAVAALAEAGEDAKVLAGGQSLLPVLRMRM
FT                   ADPGVVVDVGKIESMRGVRDEGDAIVIGAMTTHHDVLRDQLVRRHAELIALTTRTVADP
FT                   QVRHRGTFGGSLAHADPAGDLLAPVLALDAEMIIAGRAGTRTVPAAEFFVDYFTTALAP
FT                   DEILVEVRVPKFTGWSAHYEKFNRVAQAWSLVGVAAAVRIEESSIADVRVGLTAMGPTP
FT                   VRATGVEQALIGGSATAEAIREAASHAAEGTSPTGDASADPDYREHLARVLTGRAVLAA
FT                   AGG"
     gtgatccccg catcgttcga ctacatcgca ccgtccacag tggaagaggc ggtggccgcg        60
     ctggccgagg ccggtgagga cgccaaggtg ctggcgggcg ggcagagcct gctgccggtg       120
     ctgcggatgc gcatggccga ccccggggtc gtcgtcgacg tcggcaagat cgagtcgatg       180
     cgcggtgtcc gcgacgaggg cgacgcgatc gtcatcggcg ccatgaccac ccaccacgac       240
     gtgctgcgcg accagctggt ccgccggcac gccgagctga tcgcgctgac cacccgcacc       300
     gtggccgacc cgcaggtgcg ccaccgcggc accttcggcg ggtcgctggc ccacgccgac       360
     ccggcgggcg acctgctcgc cccggtgctg gcgctcgacg cggagatgat catcgccggg       420
     cgtgcaggca cgcggaccgt tcccgcggcg gagttcttcg tcgactactt cacgaccgcg       480
     ctggcacccg acgagatcct ggtcgaggtg cgggtgccga agttcaccgg ctggagcgcg       540
     cactacgaga agttcaaccg ggtcgcccag gcgtggtcgc tggtcggcgt cgcggccgcg       600
     gtgcgcatcg aggagtcctc gatcgcggac gtgcgcgtcg gcctgaccgc catgggtccg       660
     actcccgtcc gcgcgaccgg cgtcgaacag gcgctgatcg gcgggtccgc cacggccgag       720
     gcgatccgcg aggccgcctc gcacgccgcc gagggcacca gcccgacggg cgacgccagc       780
     gccgatcccg actaccggga gcacctggcc agggtgctta ccgggcgggc ggtgctcgcg       840
     gcggccggcg gctag                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page